Recombinant Full Length Pan Troglodytes Melanin-Concentrating Hormone Receptor 1(Mchr1) Protein, His-Tagged
Cat.No. : | RFL28331PF |
Product Overview : | Recombinant Full Length Pan troglodytes Melanin-concentrating hormone receptor 1(MCHR1) Protein (Q5IJ49) (1-422aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pan troglodytes |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-422) |
Form : | Lyophilized powder |
AA Sequence : | MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARL WEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTIC LLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHF GETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALS FISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRI LQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVY LYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESK GT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MCHR1 |
Synonyms | MCHR1; GPR24; Melanin-concentrating hormone receptor 1; MCH receptor 1; MCH-R1; MCHR-1; G-protein coupled receptor 24; MCH-1R; MCH1R; MCHR |
UniProt ID | Q5IJ49 |
◆ Recombinant Proteins | ||
MCHR1-2700R | Recombinant Rhesus monkey MCHR1 Protein, His-tagged | +Inquiry |
MCHR1-3273R | Recombinant Rat MCHR1 Protein, His (Fc)-Avi-tagged | +Inquiry |
MCHR1-2520R | Recombinant Rhesus Macaque MCHR1 Protein, His (Fc)-Avi-tagged | +Inquiry |
MCHR1-5508HF | Recombinant Full Length Human MCHR1 Protein, GST-tagged | +Inquiry |
RFL28331PF | Recombinant Full Length Pan Troglodytes Melanin-Concentrating Hormone Receptor 1(Mchr1) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MCHR1-4424HCL | Recombinant Human MCHR1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MCHR1 Products
Required fields are marked with *
My Review for All MCHR1 Products
Required fields are marked with *