Recombinant Full Length Pan Troglodytes Mu-Type Opioid Receptor(Oprm1) Protein, His-Tagged
Cat.No. : | RFL11084PF |
Product Overview : | Recombinant Full Length Pan troglodytes Mu-type opioid receptor(OPRM1) Protein (Q5IS39) (1-401aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pan troglodytes |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-401) |
Form : | Lyophilized powder |
AA Sequence : | MDSSAVPANASNCTDDALAYSSCSPAPSPGSWVNLSHLDGNLSDPCGPNRTDLGGRDSLC PPTGSPSMITAITIMALYSIVCVVGLFGNFLVMYVIVRYTKMKTATNIYIFNLALADALA TSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSIFTLCTMSVDRYIAVCHPVKALD FRTPRNAKIINVCNWILSSAIGLPVMFMATTKYRHGSIDCTLTFSHPTWYWENLLKICVF IFAFIMPVLIITVCYGLMILRLKSVRMLSGSKEKDRNLRRITRMVLVVVAVFIVCWTPIH IYVIIKALVTIPETTFQTVSWHFCIALGYTNSCLNPVLYAFLDENFKRCFREFCIPTSSN IEQQNSTRIRQNTRDHPSTANTVDRTNHQLENLEAETAPLP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | OPRM1 |
Synonyms | OPRM1; Mu-type opioid receptor; M-OR-1; MOR-1 |
UniProt ID | Q5IS39 |
◆ Recombinant Proteins | ||
OPRM1-301348H | Recombinant Human OPRM1 protein, GST-tagged | +Inquiry |
OPRM1-2988R | Recombinant Rhesus Macaque OPRM1 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL28592SF | Recombinant Full Length Saimiri Boliviensis Boliviensis Mu-Type Opioid Receptor(Oprm1) Protein, His-Tagged | +Inquiry |
OPRM1-3858R | Recombinant Rat OPRM1 Protein, His (Fc)-Avi-tagged | +Inquiry |
OPRM1-9229Z | Recombinant Zebrafish OPRM1 | +Inquiry |
◆ Native Proteins | ||
Oprm1-15M | Recombinant Full Length Mouse Oprm1 Protein, His tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All OPRM1 Products
Required fields are marked with *
My Review for All OPRM1 Products
Required fields are marked with *
0
Inquiry Basket