Recombinant Full Length Papio Anubis Insulin-Induced Gene 2 Protein(Insig2) Protein, His-Tagged
| Cat.No. : | RFL21862PF |
| Product Overview : | Recombinant Full Length Papio anubis Insulin-induced gene 2 protein(INSIG2) Protein (A9RA88) (1-225aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Papio anubis (Olive baboon) |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (1-225) |
| Form : | Lyophilized powder |
| AA Sequence : | MAEGETESPGPKKCGPYISSVTSQSVNLMIRGVVLFFIGVFLALVLNLLQIQRNVTLFPP DVIASIFSSAWWVPPCCGTASAVIGLLYPCIDRHLGEPHKFKREWSSVMRCVAVFVGINH ASAKVDFDNNIQLSLTLAALSIGLWWTFDRSRSGFGLGVGIAFLATLVTQLLVYNGVYQY TSPDFLYVRSWLPCIFFAGGITMGNIGRQLAMYECKVIAEKSHQE |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Applications : | SDS-PAGE |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | INSIG2 |
| Synonyms | INSIG2; Insulin-induced gene 2 protein; INSIG-2 |
| UniProt ID | A9RA88 |
| ◆ Recombinant Proteins | ||
| INSIG2-12070Z | Recombinant Zebrafish INSIG2 | +Inquiry |
| RFL9077RF | Recombinant Full Length Rat Insulin-Induced Gene 2 Protein(Insig2) Protein, His-Tagged | +Inquiry |
| RFL10815SF | Recombinant Full Length Pig Insulin-Induced Gene 2 Protein(Insig2) Protein, His-Tagged | +Inquiry |
| INSIG2-5982HF | Recombinant Full Length Human INSIG2 Protein, GST-tagged | +Inquiry |
| INSIG2-4331H | Recombinant Human INSIG2 Full Length Transmembrane protein, His&Myc-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| INSIG2-5192HCL | Recombinant Human INSIG2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All INSIG2 Products
Required fields are marked with *
My Review for All INSIG2 Products
Required fields are marked with *
