Recombinant Full Length Pelophylax Nigromaculatus Tyrosinase(Tyr) Protein, His-Tagged
Cat.No. : | RFL5511PF |
Product Overview : | Recombinant Full Length Pelophylax nigromaculatus Tyrosinase(TYR) Protein (Q04604) (20-532aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pelophylax nigromaculatus (Black-spotted frog) (Rana nigromaculata) |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (20-532) |
Form : | Lyophilized powder |
AA Sequence : | GIDGHRGGRGTHQSNIRIYSDSAPPWFTKEDISAMRFLSDSRIGHIKQNLLLFESDQTPL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | TYR |
Synonyms | TYR; TYRS; Tyrosinase; Monophenol monooxygenase |
UniProt ID | Q04604 |
◆ Recombinant Proteins | ||
TYR-2965H | Recombinant Human TYR Protein, MYC/DDK-tagged | +Inquiry |
RFL12883GF | Recombinant Full Length Chicken Tyrosinase(Tyr) Protein, His-Tagged | +Inquiry |
TYR-2655H | Recombinant Human TYR protein(281-360 aa), C-His-tagged | +Inquiry |
Tyr-9032M | Recombinant Mouse Tyr Full Length Transmembrane protein, His-tagged | +Inquiry |
TYR-1016HFL | Recombinant Full Length Human TYR Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TYR-1869HCL | Recombinant Human TYR cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TYR Products
Required fields are marked with *
My Review for All TYR Products
Required fields are marked with *