Recombinant Full Length Pig Cmp-N-Acetylneuraminate-Beta-Galactosamide-Alpha-2,3-Sialyltransferase 1(St3Gal1) Protein, His-Tagged
Cat.No. : | RFL458SF |
Product Overview : | Recombinant Full Length Pig CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 1(ST3GAL1) Protein (Q02745) (1-343aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Sus scrofa (Pig) |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-343) |
Form : | Lyophilized powder |
AA Sequence : | MAPMRKKSTLKLLTLLVLFIFLTSFFLNYSHTVVTTAWFPKQMVIELSENFKKLMKYPYRPCTCTRCIEEQRVSAWFDERFNRSMQPLLTAKNAHLEEDTYKWWLRLQREKQPNNLNDTIRELFQVVPGNVDPLLEKRLVSCRRCAVVGNSGNLKESYYGPQIDSHDFVLRMNKAPTEGFEADVGSKTTHHFVYPESFRELAQEVSMILVPFKTTDLEWVISATTTGRISHTYVPVPAKIKVKKEKILIYHPAFIKYVFDRWLQGHGRYPSTGILSVIFSLHICDEVDLYGFGADSKGNWHHYWENNPSAGAFRKTGVHDGDFESNVTTILASINKIRIFKGR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ST3GAL1 |
Synonyms | ST3GAL1; SIAT4A; CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 1; Alpha 2,3-ST 1; Beta-galactoside alpha-2,3-sialyltransferase 1; Gal-NAc6S; Gal-beta-1,3-GalNAc-alpha-2,3-sialyltransferase; Monosialoganglioside sialyltransferase; |
UniProt ID | Q02745 |
◆ Recombinant Proteins | ||
ST3GAL1-4313R | Recombinant Rhesus Macaque ST3GAL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ST3GAL1-1528H | Recombinant Human ST3GAL1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ST3GAL1-29816TH | Recombinant Human ST3GAL1 | +Inquiry |
ST3GAL1-8758M | Recombinant Mouse ST3GAL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ST3GAL1-16062M | Recombinant Mouse ST3GAL1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ST3GAL1-1442HCL | Recombinant Human ST3GAL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ST3GAL1 Products
Required fields are marked with *
My Review for All ST3GAL1 Products
Required fields are marked with *