Recombinant Full Length Pig Vesicle-Associated Membrane Protein-Associated Protein B(Vapb) Protein, His-Tagged
Cat.No. : | RFL5014SF |
Product Overview : | Recombinant Full Length Pig Vesicle-associated membrane protein-associated protein B(VAPB) Protein (A5GFS8) (2-243aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Sus scrofa (Pig) |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (2-243) |
Form : | Lyophilized powder |
AA Sequence : | AKVEQVLSLEPQHELKFRGPFTDVVTTNLKLGNPTDRNVCFKVKTTAPRRYCVRPNSGIIDAGASINVSVMLQPFDYDPNEKSKHKFMVQSMFAPADTSDMEAAWKEAKPEDLMDSKLRCVFELPAENDKPHDVEINKIISTTASKTETPVVSKALSSALDDTEVKKVMEECKRLQSEVQRLREENKQLKEEDGLRMRKPVLSNSPAPAPATPGKEEGLSTRLLALVVLFFIVGVIIGKIAL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | VAPB |
Synonyms | VAPB; Vesicle-associated membrane protein-associated protein B; VAMP-B; VAMP-associated protein B; VAP-B |
UniProt ID | A5GFS8 |
◆ Recombinant Proteins | ||
VAPB-3646H | Recombinant Human VAPB, GST-tagged | +Inquiry |
VAPB-1441C | Recombinant Chicken VAPB | +Inquiry |
VAPB-1075H | Active Recombinant Human VAPB Protein, His-tagged | +Inquiry |
VAPB-4959R | Recombinant Rhesus Macaque VAPB Protein, His (Fc)-Avi-tagged | +Inquiry |
VAPB-6499R | Recombinant Rat VAPB Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
VAPB-430HCL | Recombinant Human VAPB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All VAPB Products
Required fields are marked with *
My Review for All VAPB Products
Required fields are marked with *
0
Inquiry Basket