Recombinant Full Length Pongo Abelii Cytochrome B561(Cyb561) Protein, His-Tagged
Cat.No. : | RFL25044PF |
Product Overview : | Recombinant Full Length Pongo abelii Cytochrome b561(CYB561) Protein (Q5RCZ2) (1-251aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pongo Abelii |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-251) |
Form : | Lyophilized powder |
AA Sequence : | MEGGAAASTPAALPYYVAFSQLLGLTLVAMTGAWLGLYRGGIAWESDLQFNAHPLCMVIG LIFLQGDALLVYRVFRNEAKRTTKVLHGLLHIFALVIALVGLVAVFDYHRKEGYADLYSL HSWCGILVFVLYFVQWLVGFSFFLFPGASFSLRSRYRPQHIFFGATIFLLSVGTALLGLK EALLFKLRDKYSAFEPEGVLANVLGLLLACFGGAVLYILTRADWKRPSQAEEQALSMDFK TLTEGDSPGSQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CYB561 |
Synonyms | CYB561; Transmembrane ascorbate-dependent reductase CYB561; Cytochrome b-561; Cytochrome b561 |
UniProt ID | Q5RCZ2 |
◆ Recombinant Proteins | ||
CYB561-2209H | Recombinant Human CYB561 Protein, GST-tagged | +Inquiry |
RFL4012BF | Recombinant Full Length Bovine Cytochrome B561(Cyb561) Protein, His-Tagged | +Inquiry |
CYB561-3086H | Recombinant Human CYB561 protein, His-tagged | +Inquiry |
RFL16331HF | Recombinant Full Length Human Cytochrome B561(Cyb561) Protein, His-Tagged | +Inquiry |
CYB561-945R | Recombinant Rhesus Macaque CYB561 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CYB561-211HCL | Recombinant Human CYB561 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CYB561 Products
Required fields are marked with *
My Review for All CYB561 Products
Required fields are marked with *