Recombinant Full Length Pongo Abelii Phosphate Carrier Protein, Mitochondrial(Slc25A3) Protein, His-Tagged
| Cat.No. : | RFL30649PF |
| Product Overview : | Recombinant Full Length Pongo abelii Phosphate carrier protein, mitochondrial(SLC25A3) Protein (Q5R7W2) (50-361aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Pongo Abelii |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length of Mature Protein (50-361) |
| Form : | Lyophilized powder |
| AA Sequence : | AVEEYSCEFGSAKYYALCGFGGVLSCGLTHTAVVPLDLVKCRMQVDPQKYKGIFNGFSVT LKEDGVRGLAKGWAPTFLGYSMQGLCKFGFYEVFKVLYSNMLGEENTYLWRTSLYLAASA SAEFFADIALAPMEAAKVRIQTQPGYANTLRDAAPKMYKEEGLKAFYKGVAPLWMRQIPY TMMKFACFERTVEALYKFVVPKPRSECSKPEQLVVTFVAGYIAGVFCAIVSHPADSVVSV LNKEKGSSASLVLKRLGFKGVWKGLFARIIMIGTLTALQWFIYDSVKVYFRLPRPPPPEM PESLKKKLGLTQ |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | SLC25A3 |
| Synonyms | SLC25A3; PHC; Phosphate carrier protein, mitochondrial; Phosphate transport protein; PTP; Solute carrier family 25 member 3 |
| UniProt ID | Q5R7W2 |
| ◆ Recombinant Proteins | ||
| SLC25A3-477HF | Recombinant Full Length Human SLC25A3 Protein | +Inquiry |
| RFL31816RF | Recombinant Full Length Rat Phosphate Carrier Protein, Mitochondrial(Slc25A3) Protein, His-Tagged | +Inquiry |
| SLC25A3-8283M | Recombinant Mouse SLC25A3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| SLC25A3-4252R | Recombinant Rhesus monkey SLC25A3 Protein, His-tagged | +Inquiry |
| Slc25a3-5913M | Recombinant Mouse Slc25a3 Protein, Myc/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SLC25A3-1771HCL | Recombinant Human SLC25A3 293 Cell Lysate | +Inquiry |
| SLC25A3-1770HCL | Recombinant Human SLC25A3 293 Cell Lysate | +Inquiry |
| SLC25A3-1772HCL | Recombinant Human SLC25A3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLC25A3 Products
Required fields are marked with *
My Review for All SLC25A3 Products
Required fields are marked with *
