Recombinant Full Length Pongo Abelii Translocon-Associated Protein Subunit Gamma(Ssr3) Protein, His-Tagged
Cat.No. : | RFL29033PF |
Product Overview : | Recombinant Full Length Pongo abelii Translocon-associated protein subunit gamma(SSR3) Protein (Q5RCD7) (1-185aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pongo Abelii |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-185) |
Form : | Lyophilized powder |
AA Sequence : | MAPKGSCKQQSEEDLLLQDFSRNLSAKSSALFFGNAFIVSAIPIWLYWRIWHMDLIQSAV LYSVMTLVSTYLVAFAYKNVKFVLKHKVAQKREDAVSKEVTRKLSEADNRKMSRKEKDER ILWKKNEVADYEATTFSIFYNNTLFLVVVIVASFFILKNFNPTVNYILSISASSGLIALL STGSK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SSR3 |
Synonyms | SSR3; Translocon-associated protein subunit gamma; TRAP-gamma; Signal sequence receptor subunit gamma; SSR-gamma |
UniProt ID | Q5RCD7 |
◆ Recombinant Proteins | ||
SSR3-4307R | Recombinant Rhesus Macaque SSR3 Protein, His (Fc)-Avi-tagged | +Inquiry |
SSR3-980C | Recombinant Cynomolgus SSR3 Protein, His-tagged | +Inquiry |
SSR3-5415R | Recombinant Rat SSR3 Protein, His (Fc)-Avi-tagged | +Inquiry |
SSR3-4871C | Recombinant Chicken SSR3 | +Inquiry |
SSR3-723C | Recombinant Cynomolgus Monkey SSR3 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SSR3-1458HCL | Recombinant Human SSR3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SSR3 Products
Required fields are marked with *
My Review for All SSR3 Products
Required fields are marked with *