Recombinant Full Length Pongo Abelii Zinc Transporter Zip9(Slc39A9) Protein, His-Tagged
Cat.No. : | RFL14311PF |
Product Overview : | Recombinant Full Length Pongo abelii Zinc transporter ZIP9(SLC39A9) Protein (Q5RE57) (1-241aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pongo Abelii |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-241) |
Form : | Lyophilized powder |
AA Sequence : | MDDFISISLLSLAMLVGCYVAGIIPLAVNFSEDRLKLVTVLGAGLLCGTALAVIVPEGVH ALYEDILEDPEAARSSNSKITTTLGLVVHAAADGVALGAAASTSQTSVQLIVFVAIMLHK APAAFGLVSFLMHAGLERNRIRKHLLVFALAAPVMSMVTYLGLSKSSKEALSEVNATGVA MLFSAGTFLYVATVHVLPEVGGIGHSHKLDATGGRGLSRLEVAALVLGCLIPLILSVGHQ H |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SLC39A9 |
Synonyms | SLC39A9; ZIP9; Zinc transporter ZIP9; Solute carrier family 39 member 9; Zrt- and Irt-like protein 9; ZIP-9 |
UniProt ID | Q5RE57 |
◆ Recombinant Proteins | ||
SLC39A9-2766H | Recombinant Human SLC39A9, GST-tagged | +Inquiry |
SLC39A9-4292R | Recombinant Rhesus monkey SLC39A9 Protein, His-tagged | +Inquiry |
RFL33132MF | Recombinant Full Length Macaca Fascicularis Zinc Transporter Zip9(Slc39A9) Protein, His-Tagged | +Inquiry |
RFL20642RF | Recombinant Full Length Rat Zinc Transporter Zip9(Slc39A9) Protein, His-Tagged | +Inquiry |
SLC39A9-2204Z | Recombinant Zebrafish SLC39A9 | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLC39A9-1716HCL | Recombinant Human SLC39A9 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SLC39A9 Products
Required fields are marked with *
My Review for All SLC39A9 Products
Required fields are marked with *
0
Inquiry Basket