Recombinant Full Length Porcine Reproductive And Respiratory Syndrome Virus Glycoprotein 5(Gp5) Protein, His-Tagged
Cat.No. : | RFL7213PF |
Product Overview : | Recombinant Full Length Porcine reproductive and respiratory syndrome virus Glycoprotein 5(GP5) Protein (A0MD34) (33-201aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Porcine reproductive and respiratory syndrome virus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (33-201) |
Form : | Lyophilized powder |
AA Sequence : | DGNGNNSTYQYIYNLTICELNGTNWLSGHFEWAVETFVLYPVVTHILSLGFLTTSHFFDA LGLGAVSTAGFVGGRYVLSSVYGACAFAAFVCFVIRAAKNCMACRYARTRFTNFIVDDRG GVHRWKSPIVVEKLGKAEIGGNLVTIKHVVLEGVKAQPLTRTSAEQWEA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | GP5 |
Synonyms | GP5; 5; Glycoprotein 5; Protein GP5; G(L |
UniProt ID | A0MD34 |
◆ Recombinant Proteins | ||
GP5-4207H | Recombinant Human GP5 Protein (Met1-Gly523), C-His tagged | +Inquiry |
Gp5-6780M | Recombinant Mouse Gp5 protein, His & T7-tagged | +Inquiry |
GP5-2281R | Recombinant Rat GP5 Protein, His (Fc)-Avi-tagged | +Inquiry |
Gp5-598M | Active Recombinant Mouse Gp5 Protein, His-tagged | +Inquiry |
GP5-1366H | Recombinant Human GP5 Protein (Gln17-Pro242), N-His tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GP5 Products
Required fields are marked with *
My Review for All GP5 Products
Required fields are marked with *
0
Inquiry Basket