Recombinant Full Length Praomys Natalensis Gastrin/Cholecystokinin Type B Receptor(Cckbr) Protein, His-Tagged
Cat.No. : | RFL33926MF |
Product Overview : | Recombinant Full Length Praomys natalensis Gastrin/cholecystokinin type B receptor(CCKBR) Protein (P30796) (1-450aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mastomys natalensis (African soft-furred rat) (Praomys natalensis) |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-450) |
Form : | Lyophilized powder |
AA Sequence : | MELLKLNSSVQGPGPGSGSSLCHPGVSLLNSSSAGNLSCEPPRIRGTGTRELELAIRITL YAVIFLMSIGGNMLIIVVLGLSRRLRTVTNAFLLSLAVSDLLLAVACMPFTLLPNLMGTF IFGTVICKAVSYLMGVSVSVSTLNLVAIALERYSAICRPLQARVWQTRSHAARVILATWL LSGLLMVPYPVYTVVQPVGPRVLQCMHRWPSARVRQTWSVLLLMLLFFIPGVVMAVAYGL ISRELYLGLRFDGDNDSDTQSRVRNQGGLPGGTAPGPVHQNGGCRHVTVAGEDNDGCYVQ LPRSRLEMTTLTTPTPGPGLASANQAKLLAKKRVVRMLLVIVLLFFLCWLPIYSANTWCA FDGPGAHRALSGAPISFIHLLSYASACVNPLVYCFMHRRFRQACLDTCARCCPRPPRARP RPLPDEDPPTPSIASLSRLSYTTISTLGPG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CCKBR |
Synonyms | CCKBR; Gastrin/cholecystokinin type B receptor; CCK-B receptor; CCK-BR; Cholecystokinin-2 receptor; CCK2-R |
UniProt ID | P30796 |
◆ Recombinant Proteins | ||
CCKBR-1475M | Recombinant Mouse CCKBR protein, Fc-tagged | +Inquiry |
RFL30617OF | Recombinant Full Length Rabbit Gastrin/Cholecystokinin Type B Receptor(Cckbr) Protein, His-Tagged | +Inquiry |
CCKBR-1138C | Recombinant Chicken CCKBR | +Inquiry |
RFL12951HF | Recombinant Full Length Human Gastrin/Cholecystokinin Type B Receptor(Cckbr) Protein, His-Tagged | +Inquiry |
CCKBR-25H | Recombinant Human CCKBR protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCKBR-168HCL | Recombinant Human CCKBR lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CCKBR Products
Required fields are marked with *
My Review for All CCKBR Products
Required fields are marked with *
0
Inquiry Basket