Recombinant Full Length Pseudomonas Putida Glycerol-3-Phosphate Acyltransferase(Plsy) Protein, His-Tagged

Cat.No. : RFL24133PF
Product Overview : Recombinant Full Length Pseudomonas putida Glycerol-3-phosphate acyltransferase(plsY) Protein (Q88QU5) (1-189aa), fused to N-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Pseudomonas Putida
Source : E.coli
Tag : His
Protein Length : Full Length (1-189)
Form : Lyophilized powder
AA Sequence : MFWLLALLAYLLGSLSFAIVLSRLSGSPDPRSSGSGNAGATNMLRLAGRKLAILTLLGDL CKGLLPVLLARAAGLDLHAQAWVGICAVLGHLFPLYFRFKGGKGVATAAGMLMALYFPAA LLAIGAWLLTFYLTRTSSLAALIATPLTLPLLAWREPEALLPISVLTVMIVWRHRNNLRD LFAGRERHF
Purity : Greater than 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Storage Buffer : Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Gene Name plsY
Synonyms plsY; PP_0391; Glycerol-3-phosphate acyltransferase; Acyl-PO4 G3P acyltransferase; Acyl-phosphate--glycerol-3-phosphate acyltransferase; G3P acyltransferase; GPAT; Lysophosphatidic acid synthase; LPA synthase
UniProt ID Q88QU5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All plsY Products

Required fields are marked with *

My Review for All plsY Products

Required fields are marked with *

0
cart-icon
0
compare icon