Recombinant Full Length Rabies Virus Glycoprotein G(G) Protein, His-Tagged
Cat.No. : | RFL7204RF |
Product Overview : | Recombinant Full Length Rabies virus Glycoprotein G(G) Protein (P08667) (20-524aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rabies virus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (20-524) |
Form : | Lyophilized powder |
AA Sequence : | KFPIYTIPDKLGPWSPIDIHHLSCPNNLVVEDEGCTNLSGFSYMELKVGYISAIKMNGFT CTGVVTEAETYTNFVGYVTTTFKRKHFRPTPDACRAAYNWKMAGDPRYEESLHNPYPDYH WLRTVKTTKESLVIISPSVADLDPYDRSLHSRVFPGGNCSGVAVSSTYCSTNHDYTIWMP ENPRLGMSCDIFTNSRGKRASKGSETCGFVDERGLYKSLKGACKLKLCGVLGLRLMDGTW VAMQTSNETKWCPPGQLVNLHDFRSDEIEHLVVEELVKKREECLDALESIMTTKSVSFRR LSHLRKLVPGFGKAYTIFNKTLMEADAHYKSVRTWNEIIPSKGCLRVGGRCHPHVNGVFF NGIILGPDGNVLIPEMQSSLLQQHMELLVSSVIPLMHPLADPSTVFKNGDEAEDFVEVHL PDVHERISGVDLGLPNWGKYVLLSAGALTALMLIIFLMTCWRRVNRSEPTQHNLRGTGRE VSVTPQSGKIISSWESYKSGGETGL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | G |
Synonyms | G; Glycoprotein |
UniProt ID | P08667 |
◆ Recombinant Proteins | ||
glycoprotein G-31H | Recombinant Hendra virus glycoprotein G Protein, Sheep Fc tagged | +Inquiry |
G-292V | Recombinant RSV (A, rsb1734) G Protein, His-tagged | +Inquiry |
G-1832H | Recombinant hMPV (Strain CAN97-83) G(ΔTM) Protein | +Inquiry |
RFL30603IF | Recombinant Full Length Isfahan Virus Glycoprotein G(G) Protein, His-Tagged | +Inquiry |
RFL33954PF | Recombinant Full Length Piry Virus Glycoprotein G(G) Protein, His-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All G Products
Required fields are marked with *
My Review for All G Products
Required fields are marked with *
0
Inquiry Basket