Recombinant Full Length Rat Atp Synthase Lipid-Binding Protein, Mitochondrial(Atp5G3) Protein, His-Tagged
Cat.No. : | RFL8660RF |
Product Overview : | Recombinant Full Length Rat ATP synthase lipid-binding protein, mitochondrial(Atp5g3) Protein (Q71S46) (68-142aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (68-142) |
Form : | Lyophilized powder |
AA Sequence : | DIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAM GLFCLMVAFLILFAM |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Atp5g3 |
Synonyms | Atp5mc3; Atp5g3; ATP synthase F(0 complex subunit C3, mitochondrial; ATP synthase lipid-binding protein; ATP synthase membrane subunit c locus 3; ATP synthase proteolipid P3; ATPase protein 9; ATPase subunit c |
UniProt ID | Q71S46 |
◆ Recombinant Proteins | ||
ATP5G3-874R | Recombinant Rat ATP5G3 Protein | +Inquiry |
RFL4953HF | Recombinant Full Length Human Atp Synthase Lipid-Binding Protein, Mitochondrial(Atp5G3) Protein, His-Tagged | +Inquiry |
ATP5G3-73C | Recombinant Cynomolgus Monkey ATP5G3 Protein, His (Fc)-Avi-tagged | +Inquiry |
ATP5G3-323C | Recombinant Cynomolgus ATP5G3 Protein, His-tagged | +Inquiry |
ATP5G3-862M | Recombinant Mouse ATP5G3 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Atp5g3 Products
Required fields are marked with *
My Review for All Atp5g3 Products
Required fields are marked with *
0
Inquiry Basket