Recombinant Full Length Rat Beta-1,3-Galactosyltransferase 4(B3Galt4) Protein, His-Tagged
| Cat.No. : | RFL5968RF |
| Product Overview : | Recombinant Full Length Rat Beta-1,3-galactosyltransferase 4(B3galt4) Protein (O88178) (1-371aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rat |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (1-371) |
| Form : | Lyophilized powder |
| AA Sequence : | MPLSLFRRLLLAVLLLVIIWTLFGPSGLGEELLSLSLASLLPAPASPGPPLALPRLLIPNPQACGGSGPPPFLLILVCTAPEHLNQRNAIRGSWGAIREARGFRVQTLFLLGEPMGQQFADLASESAAQGDVLQASFQDSYRNLTLKTLTGLNWVNKYCPMARYILKTDDDVYVNVPELVSELIQRGGPSEQWQKGKEPQEETTAVHKEHKGQAVPLLYLGRVHWRVRPTRTPESRHHVSEELWPENWGPFPPYASGTGYVLSISAVQLILKVASRAPYLPLEDVFVGVSARRVGLAPTHCVKLAGATHYPLDRCCYGKFLLTSHKVDPWKMQEAWKLVRGLNGRRTEPFCSWLQGFLGTLRCRFIAWLNS |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Applications : | SDS-PAGE |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | B3galt4 |
| Synonyms | B3galt4; Beta-1,3-galactosyltransferase 4; Beta-1,3-GalTase 4; Beta3Gal-T4; Beta3GalT4; b3Gal-T4; Gal-T2; Ganglioside galactosyltransferase; UDP-galactose:beta-N-acetyl-galactosamine-beta-1,3-galactosyltransferase |
| UniProt ID | O88178 |
| ◆ Recombinant Proteins | ||
| B3GALT4-924M | Recombinant Mouse B3GALT4 Protein, His (Fc)-Avi-tagged | +Inquiry |
| RFL35550AF | Recombinant Full Length Arabidopsis Thaliana Probable Beta-1,3-Galactosyltransferase 4(B3Galt4) Protein, His-Tagged | +Inquiry |
| B3GALT4-492R | Recombinant Rhesus monkey B3GALT4 Protein, His-tagged | +Inquiry |
| B3GALT4-2232M | Recombinant Mouse B3GALT4 Protein | +Inquiry |
| B3GALT4-010H | Recombinant Human B3GALT4 protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| B3GALT4-8547HCL | Recombinant Human B3GALT4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All B3galt4 Products
Required fields are marked with *
My Review for All B3galt4 Products
Required fields are marked with *
