Recombinant Full Length Rat Calcium-Binding Mitochondrial Carrier Protein Scamc-2(Slc25A25) Protein, His-Tagged
Cat.No. : | RFL933RF |
Product Overview : | Recombinant Full Length Rat Calcium-binding mitochondrial carrier protein SCaMC-2(Slc25a25) Protein (Q8K3P6) (1-469aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-469) |
Form : | Lyophilized powder |
AA Sequence : | MLCLCLYVPIAGEAQTEFQYFESKGLPTELKSIFKLSVFIPSQEFSTYRQWKQKIVQAGD KDLDGQLDFEEFVHYLQDHEKKLRLVFKSLDKKNDGRIDAQEIMQSLRDLGVKISEQQAE KILKSMDKNGTMTIDWNEWRDYHLLHPVENIPEIILYWKHSTIFDVGENLTVPDEFTVEE RQTGMWWRHLVAGGGAGAVSRTCTAPLDRLKVLMQVHASRSNNMCIIGGFTQMIREGGAK SLWRGNGINVLKIAPESAIKFMAYEQMKRLVGSDQETLRIHERLVAGSLAGAIAQSSIYP MEVLKTRMALRKTGQYSGMLDCAKRILAKEGVAAFYKGYIPNMLGIIPYAGIDLAVYETL KNTWLQRYAVNSADPGVFVLLACGTISSTCGQLASYPLALVRTRMQAQASIEGAPEVTMS SLFKQILRTEGAFGLYRGLAPNFMKVIPAVSISYVVYENLKITLGVQSR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Slc25a25 |
Synonyms | Slc25a25; Mcsc; Pcscl; Scamc2; Calcium-binding mitochondrial carrier protein SCaMC-2; Mitochondrial ATP-Mg/Pi carrier protein; Peroxisomal Ca(2+-dependent solute carrier-like protein; Small calcium-binding mitochondrial carrier protein 2; Solute carrier f |
UniProt ID | Q8K3P6 |
◆ Recombinant Proteins | ||
SLC25A25-5472R | Recombinant Rat SLC25A25 Protein | +Inquiry |
SLC25A25-5131R | Recombinant Rat SLC25A25 Protein, His (Fc)-Avi-tagged | +Inquiry |
SLC25A25-15311M | Recombinant Mouse SLC25A25 Protein | +Inquiry |
RFL14416XF | Recombinant Full Length Xenopus Laevis Calcium-Binding Mitochondrial Carrier Protein Scamc-2(Slc25A25) Protein, His-Tagged | +Inquiry |
RFL16129HF | Recombinant Full Length Human Calcium-Binding Mitochondrial Carrier Protein Scamc-2(Slc25A25) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLC25A25-1774HCL | Recombinant Human SLC25A25 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Slc25a25 Products
Required fields are marked with *
My Review for All Slc25a25 Products
Required fields are marked with *