Recombinant Full Length Rat Cytochrome B-C1 Complex Subunit 8(Uqcrq) Protein, His-Tagged
Cat.No. : | RFL3227RF |
Product Overview : | Recombinant Full Length Rat Cytochrome b-c1 complex subunit 8(Uqcrq) Protein (Q7TQ16) (1-82aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-82) |
Form : | Lyophilized powder |
AA Sequence : | MGREFGNLTRIRHVISYSLSPFEQRAFPHYFSKGIPNVLRRTRERILRVAPPFVLFYLIY TWGNQEFAQSKRKNPAKYENDK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Uqcrq |
Synonyms | Uqcrq; Qpc; Cytochrome b-c1 complex subunit 8; Complex III subunit 8; Complex III subunit VIII; Low molecular mass ubiquinone-binding protein; Ubiquinol-cytochrome c reductase complex 9.5 kDa protein; Ubiquinol-cytochrome c reductase complex ubiquinone-bi |
UniProt ID | Q7TQ16 |
◆ Recombinant Proteins | ||
UQCRQ-623Z | Recombinant Zebrafish UQCRQ | +Inquiry |
UQCRQ-6461R | Recombinant Rat UQCRQ Protein | +Inquiry |
RFL3227RF | Recombinant Full Length Rat Cytochrome B-C1 Complex Subunit 8(Uqcrq) Protein, His-Tagged | +Inquiry |
UQCRQ-9936M | Recombinant Mouse UQCRQ Protein, His (Fc)-Avi-tagged | +Inquiry |
UQCRQ-5115R | Recombinant Rhesus monkey UQCRQ Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
UQCRQ-726HCL | Recombinant Human UQCRQ lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Uqcrq Products
Required fields are marked with *
My Review for All Uqcrq Products
Required fields are marked with *
0
Inquiry Basket