Recombinant Full Length Rat D(3) Dopamine Receptor(Drd3) Protein, His-Tagged
Cat.No. : | RFL28067RF |
Product Overview : | Recombinant Full Length Rat D(3) dopamine receptor(Drd3) Protein (P19020) (1-446aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-446) |
Form : | Lyophilized powder |
AA Sequence : | MAPLSQISTHLNSTCGAENSTGVNRARPHAYYALSYCALILAIIFGNGLVCAAVLRERAL QTTTNYLVVSLAVADLLVATLVMPWVVYLEVTGGVWNFSRICCDVFVTLDVMMCTASILN LCAISIDRYTAVVMPVHYQHGTGQSSCRRVALMITAVWVLAFAVSCPLLFGFNTTGDPSI CSISNPDFVIYSSVVSFYVPFGVTVLVYARIYIVLRQRQRKRILTRQNSQCISIRPGFPQ QSSCLRLHPIRQFSIRARFLSDATGQMEHIEDKQYPQKCQDPLLSHLQPPSPGQTHGGLK RYYSICQDTALRHPSLEGGAGMSPVERTRNSLSPTMAPKLSLEVRKLSNGRLSTSLRLGP LQPRGVPLREKKATQMVVIVLGAFIVCWLPFFLTHVLNTHCQACHVSPELYRATTWLGYV NSALNPVIYTTFNVEFRKAFLKILSC |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Drd3 |
Synonyms | Drd3; D(3 dopamine receptor; Dopamine D3 receptor |
UniProt ID | P19020 |
◆ Recombinant Proteins | ||
DRD3-1155R | Recombinant Rhesus Macaque DRD3 Protein, His (Fc)-Avi-tagged | +Inquiry |
DRD3-1616R | Recombinant Rat DRD3 Protein, His (Fc)-Avi-tagged | +Inquiry |
DRD3-2945H | Recombinant Human DRD3 protein, His-tagged | +Inquiry |
DRD3-9690Z | Recombinant Zebrafish DRD3 | +Inquiry |
Drd3-1382M | Recombinant Mouse Drd3 Protein, His&GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Drd3 Products
Required fields are marked with *
My Review for All Drd3 Products
Required fields are marked with *
0
Inquiry Basket