Recombinant Full Length Rat Fatty Acid Desaturase 2(Fads2) Protein, His-Tagged
Cat.No. : | RFL8080RF |
Product Overview : | Recombinant Full Length Rat Fatty acid desaturase 2(Fads2) Protein (Q9Z122) (1-444aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-444) |
Form : | Lyophilized powder |
AA Sequence : | MGKGGNQGEGSTELQAPMPTFRWEEIQKHNLRTDRWLVIDRKVYNVTKWSQRHPGGHRVI GHYSGEDATDAFRAFHLDLDFVGKFLKPLLIGELAPEEPSLDRGKSSQITEDFRALKKTA EDMNLFKTNHLFFFLLLSHIIVMESIAWFILSYFGNGWIPTVITAFVLATSQAQAGWLQH DYGHLSVYKKSIWNHIVHKFVIGHLKGASANWWNHRHFQHHAKPNIFHKDPDIKSLHVFV LGEWQPLEYGKKKLKYLPYNHQHEYFFLIGPPLLIPMYFQYQIIMTMIRRRDWVDLAWAI SYYARFFYTYIPFYGILGALVFLNFIRFLESHWFVWVTQMNHIVMEIDLDHYRDWFSSQL AATCNVEQSFFNDWFSGHLNFQIEHHLFPTMPRHNLHKIAPLVKSLCAKHGIEYQEKPLL RALLDIVSSLKKSGELWLDAYLHK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Fads2 |
Synonyms | Fads2; Fadsd6; Acyl-CoA 6-desaturase; Delta(6 fatty acid desaturase; D6D; Delta(6 desaturase; Delta-6 desaturase; Fatty acid desaturase 2 |
UniProt ID | Q9Z122 |
◆ Recombinant Proteins | ||
FADS2-3959C | Recombinant Chicken FADS2 | +Inquiry |
FADS2-2882H | Recombinant Human FADS2 protein, His-SUMO-tagged | +Inquiry |
FADS2-16H | Recombinant Human FADS2 Protein, His-tagged | +Inquiry |
FADS2-4436HF | Recombinant Full Length Human FADS2 Protein, GST-tagged | +Inquiry |
FADS2-1850R | Recombinant Rat FADS2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Fads2 Products
Required fields are marked with *
My Review for All Fads2 Products
Required fields are marked with *
0
Inquiry Basket