Recombinant Full Length Rat G Protein-Activated Inward Rectifier Potassium Channel 1(Kcnj3) Protein, His-Tagged
Cat.No. : | RFL30885RF |
Product Overview : | Recombinant Full Length Rat G protein-activated inward rectifier potassium channel 1(Kcnj3) Protein (P63251) (1-501aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-501) |
Form : | Lyophilized powder |
AA Sequence : | MSALRRKFGDDYQVVTTSSSGSGLQPQGPGQGPQQQLVPKKKRQRFVDKNGRCNVQHGNL GSETSRYLSDLFTTLVDLKWRWNLFIFILTYTVAWLFMASMWWVIAYTRGDLNKAHVGNY TPCVANVYNFPSAFLFFIETEATIGYGYRYITDKCPEGIILFLFQSILGSIVDAFLIGCM FIKMSQPKKRAETLMFSEHAVISMRDGKLTLMFRVGNLRNSHMVSAQIRCKLLKSRQTPE GEFLPLDQLELDVGFSTGADQLFLVSPLTICHVIDAKSPFYDLSQRSMQTEQFEVVVILE GIVETTGMTCQARTSYTEDEVLWGHRFFPVISLEEGFFKVDYSQFHATFEVPTPPYSVKE QEEMLLMSSPLIAPAITNSKERHNSVECLDGLDDISTKLPSKLQKITGREDFPKKLLRMS STTSEKAYSLGDLPMKLQRISSVPGNSEEKLVSKTTKMLSDPMSQSVADLPPKLQKMAGG PTRMEGNLPAKLRKMNSDRFT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Kcnj3 |
Synonyms | Kcnj3; Girk1; Kga; G protein-activated inward rectifier potassium channel 1; GIRK-1; Inward rectifier K(+ channel Kir3.1; KGA; KGB1; Potassium channel, inwardly rectifying subfamily J member 3 |
UniProt ID | P63251 |
◆ Recombinant Proteins | ||
KCNJ3-2360R | Recombinant Rhesus monkey KCNJ3 Protein, His-tagged | +Inquiry |
KCNJ3-2181R | Recombinant Rhesus Macaque KCNJ3 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL30885RF | Recombinant Full Length Rat G Protein-Activated Inward Rectifier Potassium Channel 1(Kcnj3) Protein, His-Tagged | +Inquiry |
KCNJ3-8518M | Recombinant Mouse KCNJ3 Protein | +Inquiry |
KCNJ3-3201R | Recombinant Rat KCNJ3 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
KCNJ3-5047HCL | Recombinant Human KCNJ3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Kcnj3 Products
Required fields are marked with *
My Review for All Kcnj3 Products
Required fields are marked with *
0
Inquiry Basket