Recombinant Full Length Rat Gap Junction Alpha-1 Protein(Gja1) Protein, His-Tagged
Cat.No. : | RFL11994RF |
Product Overview : | Recombinant Full Length Rat Gap junction alpha-1 protein(Gja1) Protein (P08050) (2-382aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (2-382) |
Form : | Lyophilized powder |
AA Sequence : | GDWSALGKLLDKVQAYSTAGGKVWLSVLFIFRILLLGTAVESAWGDEQSAFRCNTQQPGC ENVCYDKSFPISHVRFWVLQIIFVSVPTLLYLAHVFYVMRKEEKLNKKEEELKVAQTDGV NVEMHLKQIEIKKFKYGIEEHGKVKMRGGLLRTYIISILFKSVFEVAFLLIQWYIYGFSL SAVYTCKRDPCPHQVDCFLSRPTEKTIFIIFMLVVSLVSLALNIIELFYVFFKGVKDRVK GRSDPYHATTGPLSPSKDCGSPKYAYFNGCSSPTAPLSPMSPPGYKLVTGDRNNSSCRNY NKQASEQNWANYSAEQNRMGQAGSTISNSHAQPFDFPDDNQNAKKVAAGHELQPLAIVDQ RPSSRASSRASSRPRPDDLEI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Gja1 |
Synonyms | Gja1; Cxn-43; Gap junction alpha-1 protein; Connexin-43; Cx43; Gap junction 43 kDa heart protein |
UniProt ID | P08050 |
◆ Recombinant Proteins | ||
GJA1-6368M | Recombinant Mouse GJA1 Protein | +Inquiry |
Gja1-352R | Recombinant Rat Gja1 Protein, His-tagged | +Inquiry |
GJA1-1312H | Recombinant Human GJA1 protein, His-tagged | +Inquiry |
RFL25501BF | Recombinant Full Length Bovine Gap Junction Alpha-1 Protein(Gja1) Protein, His-Tagged | +Inquiry |
Gja1-951M | Recombinant Mouse Gja1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GJA1-5923HCL | Recombinant Human GJA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Gja1 Products
Required fields are marked with *
My Review for All Gja1 Products
Required fields are marked with *
0
Inquiry Basket