Recombinant Full Length Rat Gap Junction Beta-1 Protein(Gjb1) Protein, His-Tagged
Cat.No. : | RFL10059RF |
Product Overview : | Recombinant Full Length Rat Gap junction beta-1 protein(Gjb1) Protein (P08033) (1-283aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-283) |
Form : | Lyophilized powder |
AA Sequence : | MNWTGLYTLLSGVNRHSTAIGRVWLSVIFIFRIMVLVVAAESVWGDEKSSFICNTLQPGC NSVCYDHFFPISHVRLWSLQLILVSTPALLVAMHVAHQQHIEKKMLRLEGHGDPLHLEEV KRHKVHISGTLWWTYVISVVFRLLFEAVFMYVFYLLYPGYAMVRLVKCEAFPCPNTVDCF VSRPTEKTVFTVFMLAASGICIILNVAEVVYLIIRACARRAQRRSNPPSRKGSGFGHRLS PEYKQNEINKLLSEQDGSLKDILRRSPGTGAGLAEKSDRCSAC |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Gjb1 |
Synonyms | Gjb1; Cxn-32; Gap junction beta-1 protein; Connexin-32; Cx32; GAP junction 28 kDa liver protein |
UniProt ID | P08033 |
◆ Recombinant Proteins | ||
GJB1-5941C | Recombinant Chicken GJB1 | +Inquiry |
RFL10059RF | Recombinant Full Length Rat Gap Junction Beta-1 Protein(Gjb1) Protein, His-Tagged | +Inquiry |
GJB1-2551R | Recombinant Rat GJB1 Protein | +Inquiry |
RFL32297HF | Recombinant Full Length Human Gap Junction Beta-1 Protein(Gjb1) Protein, His-Tagged | +Inquiry |
GJB1-5293HF | Recombinant Full Length Human GJB1 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Gjb1 Products
Required fields are marked with *
My Review for All Gjb1 Products
Required fields are marked with *
0
Inquiry Basket