Recombinant Full Length Rat Group Xvi Phospholipase A1/A2(Pla2G16) Protein, His-Tagged
| Cat.No. : | RFL8005RF |
| Product Overview : | Recombinant Full Length Rat Group XVI phospholipase A1/A2(Pla2g16) Protein (P53817) (1-160aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rat |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (1-160) |
| Form : | Lyophilized powder |
| AA Sequence : | MPIPEPKPGDLIEIFRPMYSHWAIYVGDGYVIHLAPPSEIPGAGAASIMSALTDKAIVKKELLRDVAGKDKYQVNNKHDKEYTPLPLNKIIQRAEELVGQEVLYRLTSENCEHFVNELRYGVPRSDQVRDAVKVATVTGVGLAALGLIGVMLSRNKKQKQ |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Applications : | SDS-PAGE |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | Pla2g16 |
| Synonyms | Plaat3; H-rev107; Hrasls3; Hrev107; Pla2g16; Rlp-3; Phospholipase A and acyltransferase 3; Group XVI phospholipase A2; H-rev 107 protein homolog; HRAS-like suppressor 3; HRSL3; Rat LRAT-like protein-3; RLP-3 |
| UniProt ID | P53817 |
| ◆ Recombinant Proteins | ||
| PLA2G16-28758TH | Recombinant Human PLA2G16 | +Inquiry |
| PLA2G16-5027H | Recombinant Human PLA2G16 Protein, GST-tagged | +Inquiry |
| PLA2G16-3963H | Recombinant Human PLA2G16 Protein (Asp12-Asp132), N-His tagged | +Inquiry |
| PLA2G16-3272R | Recombinant Rhesus Macaque PLA2G16 Protein, His (Fc)-Avi-tagged | +Inquiry |
| PLA2G16-3454R | Recombinant Rhesus monkey PLA2G16 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PLA2G16-3143HCL | Recombinant Human PLA2G16 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Pla2g16 Products
Required fields are marked with *
My Review for All Pla2g16 Products
Required fields are marked with *
