Recombinant Full Length Rat Nucleolar Complex Protein 4 Homolog(Noc4L) Protein, His-Tagged
Cat.No. : | RFL24288RF |
Product Overview : | Recombinant Full Length Rat Nucleolar complex protein 4 homolog(Noc4l) Protein (Q5I0I8) (1-516aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-516) |
Form : | Lyophilized powder |
AA Sequence : | MERQPASTGSRQELGRLLEAVLSNRGRANAVFDILAVLQSEDPEEIKEGVRTCSRLFGTL LEREELFVGSLPCEDMALAGSQGATYKYKVWMRHRYHSCCNRLEELLTHPSFQVKELALE TLMKFVQLEGAKPLEKPQWESHYLFPRTLFRAVVGGLLTPEDDHSLLISQFCEYLEYDDI RYHAMQVATSILARATSRQPEVSLTFWNNAFTLLSAVNLPLQEHELTNFYVKHAQTSSKW KVVHLKEQRKAFQEMWLGFLKHKLPLSLYKKVLVAMHDSILPHLAQPTLMIDFLTSACDV GGAISLLALNGLFILIHKHNLEYPDFYQRLYGLLDPSIFHVKYRARFFHLADLFLSSSHL PAYLVAAFAKRLARLALTAPPEALLMVLPLICNLLRRHPACRVMVHRPQGPELDADPYDP TEKDPARSRALESCLWELQTLQQHYHPEVSRAASVINQALSVPEVSIAPLLELTAYEIFE QDLKKMMPESVPLEFIPAKGLLGRQDDLCTQFFCLS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Noc4l |
Synonyms | Noc4l; Nucleolar complex protein 4 homolog; NOC4 protein homolog; NOC4-like protein; Nucleolar complex-associated protein 4-like protein |
UniProt ID | Q5I0I8 |
◆ Recombinant Proteins | ||
NOC4L-3674R | Recombinant Rat NOC4L Protein, His (Fc)-Avi-tagged | +Inquiry |
NOC4L-3061R | Recombinant Rhesus monkey NOC4L Protein, His-tagged | +Inquiry |
NOC4L-10764M | Recombinant Mouse NOC4L Protein | +Inquiry |
NOC4L-3003Z | Recombinant Zebrafish NOC4L | +Inquiry |
NOC4L-4015R | Recombinant Rat NOC4L Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
NOC4L-3773HCL | Recombinant Human NOC4L 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Noc4l Products
Required fields are marked with *
My Review for All Noc4l Products
Required fields are marked with *
0
Inquiry Basket