Recombinant Full Length Rat Palmitoyltransferase Zdhhc7(Zdhhc7) Protein, His-Tagged
Cat.No. : | RFL34702RF |
Product Overview : | Recombinant Full Length Rat Palmitoyltransferase ZDHHC7(Zdhhc7) Protein (Q923G5) (1-308aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-308) |
Form : | Lyophilized powder |
AA Sequence : | MQPSGHRLRDIEHHPLLTDNDNYDSASSSSSEADMADRVWFIRDGCGMVCAVMTWLLVVY ADFVVTFVMLLPSKDFWYSVVNGVLFNCLAVLALSSHLRTMLTDPGAVPKGNATKEYMES LQLKPGEVIYKCPKCCCIKPERAHHCSICKRCIRKMDHHCPWVNNCVGEKNQRFFVLFTM YIALSSIHALILCGLQFISCVRGQWTECSDFSPPITVILLVFLCLEGLLFFTFTAVMFGT QIHSICNDETEIERLKSEKPTWERRLRWEGMKSVFGGPPSLLWMNPFVGFRFRRLQMRTR KGGPEFSV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Zdhhc7 |
Synonyms | Zdhhc7; Serz; Palmitoyltransferase ZDHHC7; Acyltransferase ZDHHC7; Sertoli cell gene with a zinc finger domain protein; Zinc finger DHHC domain-containing protein 7; DHHC7 |
UniProt ID | Q923G5 |
◆ Recombinant Proteins | ||
ZDHHC7-6666R | Recombinant Rat ZDHHC7 Protein | +Inquiry |
ZDHHC7-717Z | Recombinant Zebrafish ZDHHC7 | +Inquiry |
RFL27316MF | Recombinant Full Length Mouse Palmitoyltransferase Zdhhc7(Zdhhc7) Protein, His-Tagged | +Inquiry |
ZDHHC7-6322R | Recombinant Rat ZDHHC7 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL34702RF | Recombinant Full Length Rat Palmitoyltransferase Zdhhc7(Zdhhc7) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZDHHC7-192HCL | Recombinant Human ZDHHC7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Zdhhc7 Products
Required fields are marked with *
My Review for All Zdhhc7 Products
Required fields are marked with *