Recombinant Full Length Rat Phosphatidylethanolamine N-Methyltransferase(Pemt) Protein, His-Tagged
| Cat.No. : | RFL35389RF |
| Product Overview : | Recombinant Full Length Rat Phosphatidylethanolamine N-methyltransferase(Pemt) Protein (Q08388) (2-199aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rat |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length of Mature Protein (2-199) |
| Form : | Lyophilized powder |
| AA Sequence : | SWLLGYVDPTEPSFVAAVLTIVFNPLFWNVVARWEQRTRKLSRAFGSPYLACYSLGSIIL LLNILRSHCFTQAMMSQPKMEGLDSHTIYFLGLALLGWGLVFVLSSFYALGFTGTFLGDY FGILKESRVTTFPFSVLDNPMYWGSTANYLGWALMHASPTGLLLTVLVALVYVVALLFEE PFTAEIYRRKATRLHKRS |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Applications : | SDS-PAGE |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | Pemt |
| Synonyms | Pemt; Pempt; Phosphatidylethanolamine N-methyltransferase; PEAMT; PEMT; Phospholipid methyltransferase; PLMT |
| UniProt ID | Q08388 |
| ◆ Recombinant Proteins | ||
| PEMT-7684H | Recombinant Human PEMT protein, His-tagged | +Inquiry |
| PEMT-4374R | Recombinant Rat PEMT Protein | +Inquiry |
| PEMT-1315C | Recombinant Chicken PEMT | +Inquiry |
| PEMT-1798H | Recombinant Human PEMT protein, GST-tagged | +Inquiry |
| PEMT-4034R | Recombinant Rat PEMT Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PEMT-3301HCL | Recombinant Human PEMT 293 Cell Lysate | +Inquiry |
| PEMT-3300HCL | Recombinant Human PEMT 293 Cell Lysate | +Inquiry |
| PEMT-3299HCL | Recombinant Human PEMT 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Pemt Products
Required fields are marked with *
My Review for All Pemt Products
Required fields are marked with *



