Recombinant Full Length Rat Poly [Adp-Ribose] Polymerase 16(Parp16) Protein, His-Tagged
Cat.No. : | RFL33940RF |
Product Overview : | Recombinant Full Length Rat Poly [ADP-ribose] polymerase 16(Parp16) Protein (Q5U2Q4) (1-322aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-322) |
Form : | Lyophilized powder |
AA Sequence : | MQLSNRAAARESVSRDVLAADLRCSLFASALQSYKRDSVLRPFPASYARHDCKDFEALLA DTGRLPNLKELLQSSRDTDKQTWDLVSWILSSKILTIHSAEKAEFEKIQQLTGAPHTPVP IPDFLFEIEYFDPANARFYETKGGRDLIYAFHGSRLENFHSIIHNGLHCHLNKTSLFGEG TYLTSDLSLALIYSPHGRGWQHSLLGQTLSCVAVCEVIDHPDVKCQTKKKDSKEIDRSRA RIKHSEGGDVPPKYFVVTNNQLLRVKYLLVYSQKQPKRASSQLSWLCSHWFMVAMSLYLL LLLIVSVTNSSAFQHFWNRLKR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Parp16 |
Synonyms | Parp16; Artd15; Protein mono-ADP-ribosyltransferase PARP16; ADP-ribosyltransferase diphtheria toxin-like 15; Poly [ADP-ribose] polymerase 16; PARP-16 |
UniProt ID | Q5U2Q4 |
◆ Recombinant Proteins | ||
PARP16-4277R | Recombinant Rat PARP16 Protein | +Inquiry |
PARP16-12372M | Recombinant Mouse PARP16 Protein | +Inquiry |
Parp16-4678M | Recombinant Mouse Parp16 Protein, Myc/DDK-tagged | +Inquiry |
PARP16-1129H | Recombinant Human PARP16, GST-tagged | +Inquiry |
PARP16-3939R | Recombinant Rat PARP16 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PARP16-3428HCL | Recombinant Human PARP16 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Parp16 Products
Required fields are marked with *
My Review for All Parp16 Products
Required fields are marked with *