Recombinant Full Length Rat Receptor Expression-Enhancing Protein 6(Reep6) Protein, His-Tagged
Cat.No. : | RFL843RF |
Product Overview : | Recombinant Full Length Rat Receptor expression-enhancing protein 6(Reep6) Protein (Q5XI60) (1-211aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-211) |
Form : | Lyophilized powder |
AA Sequence : | MDGLRQRFERFLEQKNVATDALGALEARTGVEKRYLAAGALTLLGLYLLFGYGASLLCNV IGFVYPAYASVKAIESPNKEDDTVWLTYWVVYALFGLVEFFSDLLLFWFPFYYAGKCAFL LFCMTPGPWNGALLLYHRVIRPLFLKHHVALDSAASQLSGRALDIAAGITRDVLQALARG RTLVTPASASESPAALEPDPKSSQTTLLKHK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Reep6 |
Synonyms | Reep6; Dp1l1; Receptor expression-enhancing protein 6; Polyposis locus protein 1-like 1 |
UniProt ID | Q5XI60 |
◆ Recombinant Proteins | ||
REEP6-2250H | Recombinant Human REEP6, GST-tagged | +Inquiry |
Reep6-5454M | Recombinant Mouse Reep6 Protein, Myc/DDK-tagged | +Inquiry |
REEP6-4645R | Recombinant Rat REEP6 Protein, His (Fc)-Avi-tagged | +Inquiry |
REEP6-811H | Recombinant Human REEP6 Protein, MYC/DDK-tagged | +Inquiry |
REEP6-4986R | Recombinant Rat REEP6 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
REEP6-2425HCL | Recombinant Human REEP6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Reep6 Products
Required fields are marked with *
My Review for All Reep6 Products
Required fields are marked with *
0
Inquiry Basket