Recombinant Full Length Rat Serine Palmitoyltransferase Small Subunit A(Sptssa) Protein, His-Tagged
Cat.No. : | RFL11219RF |
Product Overview : | Recombinant Full Length Rat Serine palmitoyltransferase small subunit A(Sptssa) Protein (Q4G019) (1-71aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-71) |
Form : | Lyophilized powder |
AA Sequence : | MAGMALARAWKQMSWFYYQYLLVTALYMLEPWERTVFNSMLVSVVGMALYTGYVFMPQHI MAILHYFEIVQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Sptssa |
Synonyms | Sptssa; Ssspta; Serine palmitoyltransferase small subunit A; Small subunit of serine palmitoyltransferase A; ssSPTa |
UniProt ID | Q4G019 |
◆ Recombinant Proteins | ||
SPTSSA-5646C | Recombinant Chicken SPTSSA | +Inquiry |
SPTSSA-15958M | Recombinant Mouse SPTSSA Protein | +Inquiry |
SPTSSA-4457R | Recombinant Rhesus monkey SPTSSA Protein, His-tagged | +Inquiry |
RFL4041DF | Recombinant Full Length Danio Rerio Serine Palmitoyltransferase Small Subunit A(Sptssa) Protein, His-Tagged | +Inquiry |
SPTSSA-8697M | Recombinant Mouse SPTSSA Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SPTSSA-8285HCL | Recombinant Human C14orf147 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Sptssa Products
Required fields are marked with *
My Review for All Sptssa Products
Required fields are marked with *