Recombinant Full Length Rat T-Cell Surface Antigen Cd2(Cd2) Protein, His-Tagged
| Cat.No. : | RFL16935RF |
| Product Overview : | Recombinant Full Length Rat T-cell surface antigen CD2(Cd2) Protein (P08921) (23-344aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rat |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length of Mature Protein (23-344) |
| Form : | Lyophilized powder |
| AA Sequence : | RDSGTVWGALGHGINLNIPNFQMTDDIDEVRWERGSTLVAEFKRKMKPFLKSGAFEILANGDLKIKNLTRDDSGTYNVTVYSTNGTRILDKALDLRILEMVSKPMIYWECSNATLTCEVLEGTDVELKLYQGKEHLRSLRQKTMSYQWTNLRAPFKCKAVNRVSQESEMEVVNCPEKGLPLYLIVGVSAGGLLLVFFGALFIFCICKRKKRNRRRKGEELEIKASRMSTVERGPKPHSTQASAPASQNPVASQAPPPPGHHLQTPGHRPLPPSHRNREHQPKKRPPPSGTQVHQQKGPPLPRPRVQPKPPCGSGDVSLPPPN |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Applications : | SDS-PAGE |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | Cd2 |
| Synonyms | Cd2; T-cell surface antigen CD2; LFA-2; LFA-3 receptor; OX-34 antigen; T-cell surface antigen T11/Leu-5; CD antigen CD2 |
| UniProt ID | P08921 |
| ◆ Recombinant Proteins | ||
| Cd2-7141R | Recombinant Rat Cd2 protein, His-tagged | +Inquiry |
| CD2-17H | Active Recombinant Human CD2 Homodimer Protein, His&Avi tagged | +Inquiry |
| CD2-1239R | Recombinant Rat CD2 Protein | +Inquiry |
| CD2-003H | Recombinant Human CD2 Protein, DDK/His-tagged | +Inquiry |
| CD2-151H | Recombinant Human CD2 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CD2-002CCL | Recombinant Canine CD2 cell lysate | +Inquiry |
| CD2-2553HCL | Recombinant Human CD2 cell lysate | +Inquiry |
| CD2-2221MCL | Recombinant Mouse CD2 cell lysate | +Inquiry |
| CD2-1372RCL | Recombinant Rat CD2 cell lysate | +Inquiry |
| CD2-001CCL | Recombinant Cynomolgus CD2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Cd2 Products
Required fields are marked with *
My Review for All Cd2 Products
Required fields are marked with *
