Recombinant Full Length Rat Translocase Of Inner Mitochondrial Membrane Domain-Containing Protein 1(Timmdc1) Protein, His-Tagged
Cat.No. : | RFL16014RF |
Product Overview : | Recombinant Full Length Rat Translocase of inner mitochondrial membrane domain-containing protein 1(Timmdc1) Protein (Q6AY94) (1-285aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-285) |
Form : | Lyophilized powder |
AA Sequence : | MEAPPPAPRSRLCGAWGPFPRVFAAGAVAADSQSFVEDPELRSYVSDPGSSESGWDRLRQ LFVKDEQRKISKEMDYICRAALSAGIIGWAYGGIPAFIYAKRRYIEQSQAEIYHNRFDAV QSAHRAATRGFIRYGWRWSWRTAVFVTIFNTVNTGLTVYRNKDALSHFAIAGAVTGGLFR INLGLRGLVAGGIIGALLGTPMGSLLMALEKHCGETVQERRQKDREAQQEQRLEEWRRNL QVTELLPMEIESGLEKIQPEKDAQRIEELLRLPRNPASPDKQSED |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Timmdc1 |
Synonyms | Timmdc1; Complex I assembly factor TIMMDC1, mitochondrial; Translocase of inner mitochondrial membrane domain-containing protein 1; TIMM domain containing-protein 1 |
UniProt ID | Q6AY94 |
◆ Recombinant Proteins | ||
TIMMDC1-9225M | Recombinant Mouse TIMMDC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
TIMMDC1-16797M | Recombinant Mouse TIMMDC1 Protein | +Inquiry |
TIMMDC1-5732R | Recombinant Rat TIMMDC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
TIMMDC1-2555Z | Recombinant Zebrafish TIMMDC1 | +Inquiry |
TIMMDC1-6075R | Recombinant Rat TIMMDC1 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Timmdc1 Products
Required fields are marked with *
My Review for All Timmdc1 Products
Required fields are marked with *