Recombinant Full Length Rat Type 2 Lactosamine Alpha-2,3-Sialyltransferase(St3Gal6) Protein, His-Tagged
Cat.No. : | RFL16085RF |
Product Overview : | Recombinant Full Length Rat Type 2 lactosamine alpha-2,3-sialyltransferase(St3gal6) Protein (P61943) (1-331aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-331) |
Form : | Lyophilized powder |
AA Sequence : | MKGYVVAIFLSSIFLYYVLYCILWGTNGYWFPNEEMKSKNNVKNCFKKPAFASLLRFPQFYPFLCKADFVKVAATYGTNNFLLPYGVKTFESYFRSGLSKLQSCDLVGQFDTVPCKRCVVVGNGGVLKNKTLGAKIDSYDVIIRMNNGPVLGHEEEVGKRTTFRLFYPESVFSDPSHYDPNTTAVLVVFKPQDLRWLMEILIGKKINTDGFWKKPALKLIYKQYQIRILDPYIIREAAFQLLRFPRVFPKDQKPKHPTTGIIALTLAFHICSEVHLAGFKYNFYTPDSPLHYYGNATMSLMKKNAYHNLTAEQLFLKNLIKKKMVINLTQN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | St3gal6 |
Synonyms | St3gal6; Siat10; Type 2 lactosamine alpha-2,3-sialyltransferase; CMP-NeuAc:beta-galactoside alpha-2,3-sialyltransferase VI; ST3Gal VI; ST3GalVI; Sialyltransferase 10 |
UniProt ID | P61943 |
◆ Recombinant Proteins | ||
ST3GAL6-2808H | Recombinant Human ST3GAL6 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
St3gal6-6152M | Recombinant Mouse St3gal6 Protein, Myc/DDK-tagged | +Inquiry |
ST3GAL6-2853H | Recombinant Human ST3GAL6 Protein, MYC/DDK-tagged | +Inquiry |
ST3GAL6-6049C | Recombinant Chicken ST3GAL6 | +Inquiry |
ST3GAL6-1234H | Recombinant Human ST3GAL6 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All St3gal6 Products
Required fields are marked with *
My Review for All St3gal6 Products
Required fields are marked with *
0
Inquiry Basket