Recombinant Human ST3GAL6 protein, His-tagged
Cat.No. : | ST3GAL6-1234H |
Product Overview : | Recombinant Human ST3GAL6 protein(25-331 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 25-331 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. |
AASequence : | GTNVYWVAPVEMKRRNKIQPCLSKPAFASLLRFHQFHPFLCAADFRKIASLYGSDKFDLPYGMRTSAEYFRLALSKLQSCDLFDEFDNIPCKKCVVVGNGGVLKNKTLGEKIDSYDVIIRMNNGPVLGHEEEVGRRTTFRLFYPESVFSDPIHNDPNTTVILTAFKPHDLRWLLELLMGDKINTNGFWKKPALNLIYKPYQIRILDPFIIRTAAYELLHFPKVFPKNQKPKHPTTGIIAITLAFYICHEVHLAGFKYNFSDLKSPLHYYGNATMSLMNKNAYHNVTAEQLFLKDIIEKNLVINLTQD |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | ST3GAL6 ST3 beta-galactoside alpha-2,3-sialyltransferase 6 [ Homo sapiens ] |
Official Symbol | ST3GAL6 |
Synonyms | ST3GAL6; ST3 beta-galactoside alpha-2,3-sialyltransferase 6; sialyltransferase 10 (alpha 2,3 sialyltransferase VI) , SIAT10; type 2 lactosamine alpha-2,3-sialyltransferase; ST3GALVI; ST3Gal VI; alpha2,3-sialyltransferase; sialyltransferase 10 (alpha-2,3-sialyltransferase VI); CMP-NeuAc:beta-galactoside alpha-2,3-sialyltransferase VI; SIAT10; |
Gene ID | 10402 |
mRNA Refseq | NM_006100 |
Protein Refseq | NP_006091 |
MIM | 607156 |
UniProt ID | Q9Y274 |
◆ Recombinant Proteins | ||
ST3GAL6-1234H | Recombinant Human ST3GAL6 protein, His-tagged | +Inquiry |
RFL16085RF | Recombinant Full Length Rat Type 2 Lactosamine Alpha-2,3-Sialyltransferase(St3Gal6) Protein, His-Tagged | +Inquiry |
ST3GAL6-6049C | Recombinant Chicken ST3GAL6 | +Inquiry |
ST3GAL6-245HCL | Recombinant Human ST3GAL6 lysate, MYC/DDK-tagged | +Inquiry |
ST3GAL6-2808H | Recombinant Human ST3GAL6 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ST3GAL6 Products
Required fields are marked with *
My Review for All ST3GAL6 Products
Required fields are marked with *