Recombinant Human ST3GAL6 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | ST3GAL6-2808H |
| Product Overview : | ST3GAL6 MS Standard C13 and N15-labeled recombinant protein (NP_006091) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | The protein encoded by this gene is a member of the sialyltransferase family. Members of this family are enzymes that transfer sialic acid from the activated cytidine 5'-monophospho-N-acetylneuraminic acid to terminal positions on sialylated glycolipids (gangliosides) or to the N- or O-linked sugar chains of glycoproteins. This protein has high specificity for neolactotetraosylceramide and neolactohexaosylceramide as glycolipid substrates and may contribute to the formation of selectin ligands and sialyl Lewis X, a carbohydrate important for cell-to-cell recognition and a blood group antigen. |
| Molecular Mass : | 38.2 kDa |
| AA Sequence : | MRGYLVAIFLSAVFLYYVLHCILWGTNVYWVAPVEMKRRNKIQPCLSKPAFASLLRFHQFHPFLCAADFRKIASLYGSDKFDLPYGMRTSAEYFRLALSKLQSCDLFDEFDNIPCKKCVVVGNGGVLKNKTLGEKIDSYDVIIRMNNGPVLGHEEEVGRRTTFRLFYPESVFSDPIHNDPNTTVILTAFKPHDLRWLLELLMGDKINTNGFWKKPALNLIYKPYQIRILDPFIIRTAAYELLHFPKVFPKNQKPKHPTTGIIAITLAFYICHEVHLAGFKYNFSDLKSPLHYYGNATMSLMNKNAYHNVTAEQLFLKDIIEKNLVINLTQDSGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | ST3GAL6 ST3 beta-galactoside alpha-2,3-sialyltransferase 6 [ Homo sapiens (human) ] |
| Official Symbol | ST3GAL6 |
| Synonyms | ST3GAL6; ST3 beta-galactoside alpha-2,3-sialyltransferase 6; sialyltransferase 10 (alpha 2,3 sialyltransferase VI), SIAT10; type 2 lactosamine alpha-2,3-sialyltransferase; ST3GALVI; ST3Gal VI; alpha2,3-sialyltransferase; sialyltransferase 10 (alpha-2,3-sialyltransferase VI); CMP-NeuAc:beta-galactoside alpha-2,3-sialyltransferase VI; SIAT10; |
| Gene ID | 10402 |
| mRNA Refseq | NM_006100 |
| Protein Refseq | NP_006091 |
| MIM | 607156 |
| UniProt ID | Q9Y274 |
| ◆ Recombinant Proteins | ||
| ST3GAL6-6049C | Recombinant Chicken ST3GAL6 | +Inquiry |
| St3gal6-6152M | Recombinant Mouse St3gal6 Protein, Myc/DDK-tagged | +Inquiry |
| ST3GAL6-245HCL | Recombinant Human ST3GAL6 lysate, MYC/DDK-tagged | +Inquiry |
| ST3GAL6-2853H | Recombinant Human ST3GAL6 Protein, MYC/DDK-tagged | +Inquiry |
| RFL16085RF | Recombinant Full Length Rat Type 2 Lactosamine Alpha-2,3-Sialyltransferase(St3Gal6) Protein, His-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ST3GAL6 Products
Required fields are marked with *
My Review for All ST3GAL6 Products
Required fields are marked with *
