Recombinant Full Length Rat V-Type Proton Atpase Subunit E 2(Atp6V0E2) Protein, His-Tagged
Cat.No. : | RFL7576RF |
Product Overview : | Recombinant Full Length Rat V-type proton ATPase subunit e 2(Atp6v0e2) Protein (Q5EB76) (1-81aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-81) |
Form : | Lyophilized powder |
AA Sequence : | MTAHSFALPVIIFTTFWGLIGIAGPWFVPKGPNRGVIITMLVATAVCCYLFWLIAILAQL NPLFGPQLKNETIWYVRFLWE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Atp6v0e2 |
Synonyms | Atp6v0e2; V-type proton ATPase subunit e 2; V-ATPase subunit e 2; Vacuolar proton pump subunit e 2 |
UniProt ID | Q5EB76 |
◆ Recombinant Proteins | ||
TAGAPB-1272Z | Recombinant Zebrafish TAGAPB | +Inquiry |
NGB-9358Z | Recombinant Zebrafish NGB | +Inquiry |
Il25-804M | Active Recombinant Mouse Il25 | +Inquiry |
EMR1-478H | Recombinant Human EMR1 | +Inquiry |
GLYCTK-2582R | Recombinant Rat GLYCTK Protein | +Inquiry |
◆ Native Proteins | ||
A2m-695R | Native Rat Alpha-2-Macroglobulin | +Inquiry |
TF-31158TH | Native Human TF | +Inquiry |
PLG-55H | Native Human lys-Plasminogen | +Inquiry |
PRF1-55H | Native Human Perforin | +Inquiry |
Acylase-3P | Active Native Porcine Acylase | +Inquiry |
◆ Cell & Tissue Lysates | ||
COQ4-385HCL | Recombinant Human COQ4 cell lysate | +Inquiry |
Ileum-245R | Rhesus monkey Ileum Lysate | +Inquiry |
CPB1-2423MCL | Recombinant Mouse CPB1 cell lysate | +Inquiry |
PSG11-2787HCL | Recombinant Human PSG11 293 Cell Lysate | +Inquiry |
RBM34-2473HCL | Recombinant Human RBM34 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Atp6v0e2 Products
Required fields are marked with *
My Review for All Atp6v0e2 Products
Required fields are marked with *
0
Inquiry Basket