Recombinant Full Length Rat Zinc Transporter Zip9(Slc39A9) Protein, His-Tagged
| Cat.No. : | RFL20642RF |
| Product Overview : | Recombinant Full Length Rat Zinc transporter ZIP9(Slc39a9) Protein (Q3KR82) (1-287aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rat |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (1-287) |
| Form : | Lyophilized powder |
| AA Sequence : | MDDFLSISLLSLAMLVGCYVAGIIPLAVNFSEERLKLVTVLGAGLLCGTALAVIVPEGVH ALYEEVLEGKHHQASEAKQNVIASDKAAEISVVHEHEHSHDHTQLHAYIGVSLVLGFVFM LLVDQIGSSHVHSTDDPESARPSSSKITTTLGLVVHAAADGVALGAAASTSQTSVQLIVF VAIMLHKAPAAFGLVSFLMHAGLERNRIRKHLLVFALAAPAMSMLTYLGLSKSSKEALSE VNATGVAMLFSAGTFLYVATVHVLPEDTSTNQSGSSLSPRPLPSGKN |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | Slc39a9 |
| Synonyms | Slc39a9; Zip9; Zinc transporter ZIP9; Solute carrier family 39 member 9; Zrt- and Irt-like protein 9; ZIP-9 |
| UniProt ID | Q3KR82 |
| ◆ Recombinant Proteins | ||
| RFL33132MF | Recombinant Full Length Macaca Fascicularis Zinc Transporter Zip9(Slc39A9) Protein, His-Tagged | +Inquiry |
| SLC39A9-8371M | Recombinant Mouse SLC39A9 Protein, His (Fc)-Avi-tagged | +Inquiry |
| RFL20642RF | Recombinant Full Length Rat Zinc Transporter Zip9(Slc39A9) Protein, His-Tagged | +Inquiry |
| SLC39A9-5536R | Recombinant Rat SLC39A9 Protein | +Inquiry |
| SLC39A9-15442M | Recombinant Mouse SLC39A9 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SLC39A9-1716HCL | Recombinant Human SLC39A9 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Slc39a9 Products
Required fields are marked with *
My Review for All Slc39a9 Products
Required fields are marked with *
