Recombinant Full Length Rhizopus Oryzae Fk506-Binding Protein 2A(Fkbp2) Protein, His-Tagged
| Cat.No. : | RFL27816RF |
| Product Overview : | Recombinant Full Length Rhizopus oryzae FK506-binding protein 2A(FKBP2) Protein (P0C1J4) (22-167aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rhizopus delemar |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length of Mature Protein (22-167) |
| Form : | Lyophilized powder |
| AA Sequence : | AKSESTINKPEKCGLKASSSSTVRIHYRSRVWGQEEYFESTYIREAPLEVKLGNGNLLKG IEDGIHGMCTGEIRRLLIPPNQAYGAIGIPNLVPPNTAIVVDVEMVNVNSPFSLWFWISG LILFSAFLLFGRKPIKGDTSNIKKKE |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Applications : | SDS-PAGE |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | FKBP2 |
| Synonyms | FKBP2; fpr2; RO3G_06709; FK506-binding protein 2A; Peptidyl-prolyl cis-trans isomerase; PPIase; Rotamase |
| UniProt ID | P0C1J4 |
| ◆ Recombinant Proteins | ||
| FKBP2-3268M | Recombinant Mouse FKBP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| FKBP2-4188H | Recombinant Human FKBP2 Protein, GST-tagged | +Inquiry |
| Fkbp2-3025M | Recombinant Mouse Fkbp2 Protein, Myc/DDK-tagged | +Inquiry |
| FKBP2-5906M | Recombinant Mouse FKBP2 Protein | +Inquiry |
| FKBP2-2033H | Recombinant Human FK506 Binding Protein 2, 13kDa, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FKBP2-6207HCL | Recombinant Human FKBP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FKBP2 Products
Required fields are marked with *
My Review for All FKBP2 Products
Required fields are marked with *



