Recombinant Full Length Saccharomyces Cerevisiae Prohibitin-2(Phb2) Protein, His-Tagged
Cat.No. : | RFL31235SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae Prohibitin-2(PHB2) Protein (P50085) (1-310aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-310) |
Form : | Lyophilized powder |
AA Sequence : | MNRSPGEFQRYAKAFQKQLSKVQQTGGRGQVPSPRGAFAGLGGLLLLGGGALFINNALFN VDGGHRAIVYSRIHGVSSRIFNEGTHFIFPWLDTPIIYDVRAKPRNVASLTGTKDLQMVN ITCRVLSRPDVVQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQREKVSRL IRENLVRRASKFNILLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDKARQEKQG MVVRAQGEAKSAELIGEAIKKSRDYVELKRLDTARDIAKILASSPNRVILDNEALLLNTV VDARIDGRGK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | PHB2 |
Synonyms | PHB2; YGR231C; G8561; Prohibitin-2 |
UniProt ID | P50085 |
◆ Recombinant Proteins | ||
RFL31235SF | Recombinant Full Length Saccharomyces Cerevisiae Prohibitin-2(Phb2) Protein, His-Tagged | +Inquiry |
PHB2-1674H | Recombinant Human PHB2, GST-tagged | +Inquiry |
PHB2-12709M | Recombinant Mouse PHB2 Protein | +Inquiry |
RFL13572SF | Recombinant Full Length Schizosaccharomyces Pombe Prohibitin-2(Phb2) Protein, His-Tagged | +Inquiry |
PHB2-3640C | Recombinant Chicken PHB2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
PHB2-3240HCL | Recombinant Human PHB2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PHB2 Products
Required fields are marked with *
My Review for All PHB2 Products
Required fields are marked with *
0
Inquiry Basket