Recombinant Full Length Saccharomyces Cerevisiae Protein Nsg1(Nsg1) Protein, His-Tagged
Cat.No. : | RFL27514SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae Protein NSG1(NSG1) Protein (P38837) (1-291aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-291) |
Form : | Lyophilized powder |
AA Sequence : | MGKKKSKNQLNTGGVPNGVHNTKKEAALPPLGNKLGSASFTAINTLTKPALFSFYDDDIT KNEGNVYDKALLSNASQLEMVPPSATARHERSLYAKIINTIAAFFILFIAGILFPMISEC LFDNDQLAKGDIVSFLKHGIEIKNKIVAEPDMVPDWAVFGTEGVIFGSIVPFIDSFVRYQ HQPKTRSSVYKNTLGSFIRCANTLLGLIFGIRKLEWSSSLQAAGAWSLLNIVLWLFFDGT LTVFFPGLVIGALSAFTCSQCFSQLSLALYFIDFYFFGFLMFSKLGRYLFN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | NSG1 |
Synonyms | NSG1; YHR133C; Protein NSG1; INSIG homolog 1 |
UniProt ID | P38837 |
◆ Recombinant Proteins | ||
NSG1-1612H | Recombinant Human NSG1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
NSG1-2517HF | Recombinant Full Length Human NSG1 Protein, GST-tagged | +Inquiry |
NSG1-501C | Recombinant Cynomolgus Monkey NSG1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Nsg1-4508M | Recombinant Mouse Nsg1 Protein, Myc/DDK-tagged | +Inquiry |
NSG1-332H | Recombinant Human NSG1 protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NSG1-213HCL | Recombinant Human NSG1 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NSG1 Products
Required fields are marked with *
My Review for All NSG1 Products
Required fields are marked with *
0
Inquiry Basket