Recombinant Full Length Saccharomyces Cerevisiae Protein Per1(Per1) Protein, His-Tagged
Cat.No. : | RFL24629SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae Protein PER1(PER1) Protein (P25625) (22-357aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (22-357) |
Form : | Lyophilized powder |
AA Sequence : | DNLDEFIDCTYACEYNRRCPNSQINYIDPETNMFHDIEFFDTPPLYSKLLFWDCISDCDY QCQHIITRWRIDEEEEIYQFHGKWPFLRVLGTQEFFSTIFSIGNFIPHYKGFVKFSRIIR EEGDRRRKNSRSILIWNYLYVTVAGMLAWTASSVFHCRDLIITEKLDYFFAGLTVLTGFH AIFARMTSMFLYPKIAQAFTASVAAIFALHILRLYVDWSYTYNMRFNIFFGVLQYILLIM LSCQNYHALQKQKLMGEFKKTAYSSFKRQIFKLCVIPILLVIVTTMAMSLELFDFFSYEW QIDAHALWHLCTIWPSWVLYDFFLEDYAYWGNRQLY |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | PER1 |
Synonyms | PER1; COS16; YCR044C; YCR44C; Protein PER1; Protein processing in the ER protein 1 |
UniProt ID | P25625 |
◆ Recombinant Proteins | ||
PER1-1864H | Recombinant Human PER1 protein, GST-tagged | +Inquiry |
RFL24629SF | Recombinant Full Length Saccharomyces Cerevisiae Protein Per1(Per1) Protein, His-Tagged | +Inquiry |
PER1-6636M | Recombinant Mouse PER1 Protein, His (Fc)-Avi-tagged | +Inquiry |
PER1-3730H | Recombinant Human PER1 protein, His-tagged | +Inquiry |
PER1-2576H | Recombinant Human PER1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PER1-1332HCL | Recombinant Human PER1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PER1 Products
Required fields are marked with *
My Review for All PER1 Products
Required fields are marked with *
0
Inquiry Basket