Recombinant Full Length Saccharomyces Cerevisiae Reticulon-Like Protein 2(Rtn2) Protein, His-Tagged
Cat.No. : | RFL19423SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae Reticulon-like protein 2(RTN2) Protein (Q12443) (1-393aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-393) |
Form : | Lyophilized powder |
AA Sequence : | MNRNTTTNKNANLNNSRNANAPGEAGHQNKTGLIYWTNPSKSGASFAATLVSLLILRNVN VISVLLKIGYMVLFTSFAVELSTKVLFDKGVVSRFGMQESPDLVGVLKPHIDRELDRLPA LEDRIRKLVFAHRTRNNFTIGVSLYFLHGLFAIFSMNTVLIMTTIFLYTVPLIYDRKQAR IDRAIDRMKDLVIHRFHKNYNKVVEKTEPYIDKIIPPQTDEGSYSTSISNENKSSTSQRN KSGLSSSEFDNMNDTSASKSGKDSYSTSQYNRAEYPVSQNENIGTLKSGKQEIPTEKDFN NRHENFSKPDVKTYDPRTVDIEEELAAHQRELEQNLKDGDYNLVGSKEIPDPITVPAPTR HTTKPAESQSIPIKNNETLHKTTHGLKQKLQHA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | RTN2 |
Synonyms | RTN2; YDL204W; D1062; Reticulon-like protein 2 |
UniProt ID | Q12443 |
◆ Recombinant Proteins | ||
RFL19209XF | Recombinant Full Length Xenopus Laevis Reticulon-2(Rtn2) Protein, His-Tagged | +Inquiry |
RTN2-7840M | Recombinant Mouse RTN2 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL28512MF | Recombinant Full Length Mouse Reticulon-2(Rtn2) Protein, His-Tagged | +Inquiry |
RTN2-2463H | Recombinant Human RTN2, GST-tagged | +Inquiry |
RFL14642XF | Recombinant Full Length Xenopus Tropicalis Reticulon-2(Rtn2) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RTN2-2123HCL | Recombinant Human RTN2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RTN2 Products
Required fields are marked with *
My Review for All RTN2 Products
Required fields are marked with *
0
Inquiry Basket