Recombinant Full Length Saccharomyces Cerevisiae Upf0041 Protein Fmp37(Fmp37) Protein, His-Tagged
| Cat.No. : | RFL25683SF |
| Product Overview : | Recombinant Full Length Saccharomyces cerevisiae UPF0041 protein FMP37(FMP37) Protein (P53157) (1-130aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | S.cerevisiae |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (1-130) |
| Form : | Lyophilized powder |
| AA Sequence : | MSQPVQRAAARSFLQKYINKETLKYIFTTHFWGPVSNFGIPIAAIYDLKKDPTLISGPMT FALVTYSGVFMKYALSVSPKNYLLFGCHLINETAQLAQGYRFLKYTYFTTDEEKKALDKE WKEKEKTGKQ |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | MPC1 |
| Synonyms | MPC1; FMP37; YGL080W; Mitochondrial pyruvate carrier 1; MPC1; Protein FMP37 |
| UniProt ID | P53157 |
| ◆ Recombinant Proteins | ||
| RFL17536MF | Recombinant Full Length Mouse Brain Protein 44-Like Protein(Brp44L) Protein, His-Tagged | +Inquiry |
| Mpc1-4122M | Recombinant Mouse Mpc1 Protein, Myc/DDK-tagged | +Inquiry |
| MPC1-5643M | Recombinant Mouse MPC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| MPC1-535Z | Recombinant Zebrafish MPC1 | +Inquiry |
| MPC1-9977M | Recombinant Mouse MPC1 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MPC1-8404HCL | Recombinant Human BRP44L 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MPC1 Products
Required fields are marked with *
My Review for All MPC1 Products
Required fields are marked with *



