Recombinant Full Length Saccharomyces Monacensis Protein Orm1(Orm1) Protein, His-Tagged
Cat.No. : | RFL23453SF |
Product Overview : | Recombinant Full Length Saccharomyces monacensis Protein ORM1(ORM1) Protein (Q96495) (1-148aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Saccharomyces pastorianus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-148) |
Form : | Lyophilized powder |
AA Sequence : | MNATWVDQRGAWIIHVVVITLLKLFFNLFPGVTAEWSWTLTNMTYVVGSYVMFHLIKGTP FDFNGGAYDNLTMWEQIDDETLFTPSRKFLIIVPIALFLVSTHYAHYDLKMFSWNCFLTT FVAVVPKLPVTHRLRISIPGITGRAQIS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ORM1 |
Synonyms | ORM1; Protein ORM1 |
UniProt ID | Q96495 |
◆ Recombinant Proteins | ||
ORM1-638HFL | Recombinant Full Length Human ORM1 Protein, C-Flag-tagged | +Inquiry |
ORM1-1586H | Recombinant Human ORM1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Orm1-4602M | Recombinant Mouse Orm1 Protein, Myc/DDK-tagged | +Inquiry |
ORM1-6407M | Recombinant Mouse ORM1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ORM1-6110C | Recombinant Chicken ORM1 | +Inquiry |
◆ Native Proteins | ||
ORM1-110H | Native Human Alpha 1 Acid Glycoprotein (A1AGP) | +Inquiry |
ORM1-27283TH | Native Human ORM1 | +Inquiry |
ORM1-8013H | Native Human Serum Alpha-1-Acid GlycoProtein | +Inquiry |
ORM1-26392TH | Native Human ORM1 | +Inquiry |
ORM1-8017R | Native Rat Serum Alpha-1-Acid GlycoProtein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ORM1-3549HCL | Recombinant Human ORM1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ORM1 Products
Required fields are marked with *
My Review for All ORM1 Products
Required fields are marked with *