Recombinant Full Length Saccharomyces Monacensis Protein Orm1(Orm1) Protein, His-Tagged
| Cat.No. : | RFL23453SF |
| Product Overview : | Recombinant Full Length Saccharomyces monacensis Protein ORM1(ORM1) Protein (Q96495) (1-148aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Saccharomyces pastorianus |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (1-148) |
| Form : | Lyophilized powder |
| AA Sequence : | MNATWVDQRGAWIIHVVVITLLKLFFNLFPGVTAEWSWTLTNMTYVVGSYVMFHLIKGTP FDFNGGAYDNLTMWEQIDDETLFTPSRKFLIIVPIALFLVSTHYAHYDLKMFSWNCFLTT FVAVVPKLPVTHRLRISIPGITGRAQIS |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | ORM1 |
| Synonyms | ORM1; Protein ORM1 |
| UniProt ID | Q96495 |
| ◆ Recombinant Proteins | ||
| Orm1-7746M | Recombinant Mouse Orm1 protein, His-tagged | +Inquiry |
| ORM1-0581H | Recombinant Human ORM1 Protein (Gln19-Ser201), His-tagged | +Inquiry |
| ORM1-7750R | Recombinant Rabbit ORM1 protein, His & T7-tagged | +Inquiry |
| ORM1-12189M | Recombinant Mouse ORM1 Protein | +Inquiry |
| RFL9892SF | Recombinant Full Length Saccharomyces Cerevisiae Protein Orm1(Orm1) Protein, His-Tagged | +Inquiry |
| ◆ Native Proteins | ||
| ORM1-5323H | Native Human Orosomucoid 1 | +Inquiry |
| ORM1-27283TH | Native Human ORM1 | +Inquiry |
| ORM1-110H | Native Human Alpha 1 Acid Glycoprotein (A1AGP) | +Inquiry |
| ORM1-8016R | Native Rabbit Serum Alpha-1-Acid GlycoProtein | +Inquiry |
| ORM1-8013H | Native Human Serum Alpha-1-Acid GlycoProtein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ORM1-3549HCL | Recombinant Human ORM1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ORM1 Products
Required fields are marked with *
My Review for All ORM1 Products
Required fields are marked with *



