Recombinant Full Length Saguinus Oedipus Membrane Cofactor Protein(Cd46) Protein, His-Tagged
Cat.No. : | RFL9177SF |
Product Overview : | Recombinant Full Length Saguinus oedipus Membrane cofactor protein(CD46) Protein (O62837) (33-370aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Saguinus oedipus (Cotton-top tamarin) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (33-370) |
Form : | Lyophilized powder |
AA Sequence : | DACGPPPTFEAMELTSRPKPYYKVGERVEYDCKKGYHHFAPFLTHSICDRNHTWLPISDEPCVRKVCHYIPNPLHGEAILANGSYSFGNQLHFICNDGYYLIGKEILYCELKGSDAVWSGRPPICQKILCKPPPKINNGKHTFSDVDVFEYLDAVTYSCDPAPGPDPFSLIGESTIYCRDNSVWSGDAPECKVVKCRFPVIENGKQIAGFGKKFYYKATVIFECDEGFHIIGSDTIVCNSNSTWDPPVPKCVKVSTSPATVSPTSSVPGYPNPDEGMLNSLDEWAIALIVIAILVGVAIISFGLHRYLQRRKKKGKADGTAEYATYQSKSATLAEQRS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CD46 |
Synonyms | CD46; MCP; Membrane cofactor protein; CD antigen CD46 |
UniProt ID | O62837 |
◆ Native Proteins | ||
CPB2-8517H | Active Native Human CPB2 | +Inquiry |
IBVQ0291-229I | Native Influenza (B/Qingdao/102/91) IBVQ0291 protein | +Inquiry |
Lectin-1760A | Active Native Agaricus bisporus lectin Protein | +Inquiry |
C3a-08H | Native Human Complement C3 alpha protein | +Inquiry |
ACTB-325H | Active Native Human ACTB | +Inquiry |
◆ Cell & Tissue Lysates | ||
Spleen-120M | Mouse Spleen Tissue Lysate (14 Days Old) | +Inquiry |
LRRN3-504HCL | Recombinant Human LRRN3 cell lysate | +Inquiry |
IL13RA2-2921HCL | Recombinant Human IL13RA2 cell lysate | +Inquiry |
CA6-266HCL | Recombinant Human CA6 cell lysate | +Inquiry |
CYP27B1-7118HCL | Recombinant Human CYP27B1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CD46 Products
Required fields are marked with *
My Review for All CD46 Products
Required fields are marked with *
0
Inquiry Basket