Recombinant Full Length Schizosaccharomyces Pombe Uba Domain-Containing Protein 14(Ucp14) Protein, His-Tagged
Cat.No. : | RFL5242SF |
Product Overview : | Recombinant Full Length Schizosaccharomyces pombe UBA domain-containing protein 14(ucp14) Protein (Q9UTK7) (1-372aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Schizosaccharomyces pombe |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-372) |
Form : | Lyophilized powder |
AA Sequence : | MSSANIVPSNMGITKFLLLTISTSSVVAGVFALKPFFHINFGLHLLSHYQYWRILLWQFI YWNSTEVFQALFIIYQARDVERLLGSHRFASFCVYMFILGMFVTPIFSFLYSLLFKNLDY IQPGPTFLIFAILYQYYYIVPSTVFVRLFNIKFTDKFQMVIPMIGLAFSHFPSTFINAFL GWTMGMFYHLSLLPGTSWRLPIRFVKPALSPTHVFIRPPYSDMQNASTFNPETLFALPTG LDAERTENENQVENPVSNADANDSPTRQNARATAIASSSNTAASFRNRQQISHPPLGRTS SSSVLPTGPASQLYDMLSGRSERPELGNIREEDINTVQTIMQTSRAQAIQALSQTNDVQR AVELLLEQTADY |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | dsc2 |
Synonyms | dsc2; ucp14; SPAC1486.02c; DSC E3 ubiquitin ligase complex subunit 2; Defective for SREBP cleavage protein 2; RING-type E3 ubiquitin transferase DSC2; UBA domain-containing protein 14 |
UniProt ID | Q9UTK7 |
◆ Recombinant Proteins | ||
DSC2-2821H | Recombinant Human DSC2 protein(771-890 aa), C-His-tagged | +Inquiry |
DSC2-478H | Recombinant Human DSC2 Protein, His-tagged | +Inquiry |
RFL5362MF | Recombinant Full Length Mouse Desmocollin-2(Dsc2) Protein, His-Tagged | +Inquiry |
DSC2-2352R | Recombinant Rat DSC2 protein(Met1-Pro694), hFc-tagged | +Inquiry |
DSC2-2534M | Recombinant Mouse DSC2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DSC2-1159RCL | Recombinant Rat DSC2 cell lysate | +Inquiry |
DSC2-2051HCL | Recombinant Human DSC2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All dsc2 Products
Required fields are marked with *
My Review for All dsc2 Products
Required fields are marked with *