Recombinant Full Length Schizosaccharomyces Pombe Vacuolar Transporter Chaperone 1(Nrf1) Protein, His-Tagged
Cat.No. : | RFL27048SF |
Product Overview : | Recombinant Full Length Schizosaccharomyces pombe Vacuolar transporter chaperone 1(nrf1) Protein (Q9UR17) (1-122aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Schizosaccharomyces pombe |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-122) |
Form : | Lyophilized powder |
AA Sequence : | MSTQPLLQTTPGKRIALPVRVEPKVFFANERTFLSWLSFAVVLGGLSVGLLNFGDRIGKI SAGLFTIVAIGTMGYALGIYHWRASAIRRRGSGPYDDRLGPTILCFVLLAAIITNFVLRM LF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | nrf1 |
Synonyms | nrf1; vtc1; SPBC21B10.04c; Vacuolar transporter chaperone 1; Negative regulator of cdc42 |
UniProt ID | Q9UR17 |
◆ Recombinant Proteins | ||
Nrf1-4499M | Recombinant Mouse Nrf1 Protein, Myc/DDK-tagged | +Inquiry |
NRF1-1800M | Recombinant Mouse NRF1 Protein (1-503 aa), His-SUMO-tagged | +Inquiry |
NRF1-2353C | Recombinant Chicken NRF1 | +Inquiry |
NRF1-1546H | Recombinant Human NRF1 Protein, His (Fc)-Avi-tagged | +Inquiry |
NRF1-1538H | Recombinant Human NRF1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
NRF1-3698HCL | Recombinant Human NRF1 293 Cell Lysate | +Inquiry |
NRF1-3699HCL | Recombinant Human NRF1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All nrf1 Products
Required fields are marked with *
My Review for All nrf1 Products
Required fields are marked with *