Recombinant Full Length Solanum Tuberosum Phosphatidate Cytidylyltransferase(Cds1) Protein, His-Tagged
Cat.No. : | RFL19914SF |
Product Overview : | Recombinant Full Length Solanum tuberosum Phosphatidate cytidylyltransferase(CDS1) Protein (O04940) (1-424aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Solanum tuberosum (Potato) |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-424) |
Form : | Lyophilized powder |
AA Sequence : | MHNDSNSGAPGTPSGRIRRRRGSNEVPPEVVKANGNHLLVNDRSKYKSMLIRAYSSVWMI GGFAFIIYMGHLYIWAMVVVIQIFMAKELFNLLRRAHEDRHLPGFRLLNWHFFFTAMLFV YGRMLSQRLVNTVTLDKFLYKLVGRFVKYHMVTCYFFYIAGFMWFILTLKKKMYKYQFSQ YAWTHMILIVVFTQSAFTVANIFEGIFWFLLPASLIVINDIAAYFFGFFFGRTPLIKLSP KKTWEGFIGASITTIISAFLLANMFGRFQWLTCPRKDLSTGWLDCDPGPLFKPEYFTLPE WFPAWFLSREIAVLPVQWHALLLGLFASIIAPFGGFFASGFKRAFKIKDFGDSIPGHGGM TDRMDCQMVMAVFAYIYHQSFIVPQNLSIEMILDQIILNLTFEEQLAVYKKLGQIIQERT FGES |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CDS1 |
Synonyms | CDS1; Phosphatidate cytidylyltransferase 1; CDP-DAG synthase; CDP-DG synthase; CDP-diacylglycerol synthase; CDS; CDP-diglyceride pyrophosphorylase; CDP-diglyceride synthase; CTP:phosphatidate cytidylyltransferase |
UniProt ID | O04940 |
◆ Recombinant Proteins | ||
CDS1-1319R | Recombinant Rat CDS1 Protein | +Inquiry |
CDS1-1547M | Recombinant Mouse CDS1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CDS1-3237M | Recombinant Mouse CDS1 Protein | +Inquiry |
CDS1-977R | Recombinant Rat CDS1 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL28904AF | Recombinant Full Length Arabidopsis Thaliana Phosphatidate Cytidylyltransferase(Cds1) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CDS1-7605HCL | Recombinant Human CDS1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CDS1 Products
Required fields are marked with *
My Review for All CDS1 Products
Required fields are marked with *
0
Inquiry Basket