Recombinant Full Length Sorghum Bicolor Obtusifoliol 14-Alpha Demethylase(Cyp51) Protein, His-Tagged
Cat.No. : | RFL21939SF |
Product Overview : | Recombinant Full Length Sorghum bicolor Obtusifoliol 14-alpha demethylase(CYP51) Protein (P93846) (1-492aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Sorghum bicolor (Sorghum) (Sorghum vulgare) |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-492) |
Form : | Lyophilized powder |
AA Sequence : | MDLADIPQQQRLMAGLALVVATVIFLKLLLSFRSGGGKKRLPPTIPGAPVVGGLVKFMRG PIPMIREQYAALGSVFTVPIITRRITFLIGPEVSAHFFKGNEAEMSQQEVYRFNVPTFGP GVVFDVDYSVRQEQFRFFTEALRANKLRSYVDQMVAEAEEYFSKWGESGTVDLKYELEHL IILTASRCLLGREVREKLFDDVSALFHDLDNGIQPISVLFPYLPIPAHKRRDKARARLAE IFATIIKSRKASGQSEEDMLQCFIDSKYKNGRPTTEGEVTGLLIAALFAGQHTSSITSTW TGAYMLRFKQYFAEAVEEQKDVMKRHGDKIDHDILAEMDVLYRCIKEALRLHPPLIMLLR QSHSDFTVTTKEGKEYDIPKGHIVATSPSFANRLPHIYKNPDSYDPDRFGPGREEDKAAG AFSYISFGGGRHGCLGEPFAYLQIKAIWTHLLRNFEFELVSPFPENDWNAMVVGIKGEVM VNYKRRKLVVDN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CYP51 |
Synonyms | CYP51; Obtusifoliol 14-alpha demethylase; CYPLI; Cytochrome P450 51; Cytochrome P450-LIA1 |
UniProt ID | P93846 |
◆ Recombinant Proteins | ||
CYP51-1415R | Recombinant Rat CYP51 Protein, His (Fc)-Avi-tagged | +Inquiry |
CYP51-1756R | Recombinant Rat CYP51 Protein | +Inquiry |
cyp51-5388M | Recombinant Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) cyp51 protein, His-Myc-tagged | +Inquiry |
RFL371PF | Recombinant Full Length Eburicol 14-Alpha-Demethylase(Cyp51) Protein, His-Tagged | +Inquiry |
Cyp51-2424M | Recombinant Mouse Cyp51 Protein, Myc/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CYP51 Products
Required fields are marked with *
My Review for All CYP51 Products
Required fields are marked with *
0
Inquiry Basket