Recombinant Full Length Talpa Europaea Aquaporin-2(Aqp2) Protein, His-Tagged
| Cat.No. : | RFL-6948TF |
| Product Overview : | Recombinant Full Length Talpa europaea Aquaporin-2(AQP2) Protein (O77740) (1-109aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Talpa europaea (European mole) |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (1-109) |
| Form : | Lyophilized powder |
| AA Sequence : | SIAFSRAVFAEFLATLIFVFFGLGSALNWQQSLPSVLQIAMAFGLAIGTLVQALGHISGAHINPAVTVACLVGCHVSFLRAAFYVAAQLLGAVAGAALLHEVTPSDVRG |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Applications : | SDS-PAGE |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | AQP2 |
| Synonyms | AQP2; Aquaporin-2; AQP-2; ADH water channel; Aquaporin-CD; AQP-CD; Collecting duct water channel protein; WCH-CD; Water channel protein for renal collecting duct; Fragment |
| UniProt ID | O77740 |
| ◆ Recombinant Proteins | ||
| AQP2-3593H | Recombinant Human AQP2, His-tagged, GST-tagged | +Inquiry |
| RFL-13721MF | Recombinant Full Length Macroscelides Proboscideus Aquaporin-2(Aqp2) Protein, His-Tagged | +Inquiry |
| Aqp2-3597M | Recombinant Mouse Aqp2, His-tagged | +Inquiry |
| Aqp2-1953M | Recombinant Mouse Aqp2 Full Length Transmembrane protein, His-tagged | +Inquiry |
| RFL-16287OF | Recombinant Full Length Rabbit Aquaporin-2(Aqp2) Protein, His-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AQP2 Products
Required fields are marked with *
My Review for All AQP2 Products
Required fields are marked with *



